KEGG   Chlamydia trachomatis D/UW-3/CX: CT_745Help
Entry
CT_745            CDS       T00017                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ctr  Chlamydia trachomatis D/UW-3/CX
Pathway
ctr00860  Porphyrin and chlorophyll metabolism
ctr01100  Metabolic pathways
ctr01110  Biosynthesis of secondary metabolites
Module
ctr_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ctr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT_745 (hemG)
Enzymes [BR:ctr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CT_745 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CT_745 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO Thi4 FAD_binding_3 FAD_binding_2 NAD_binding_9 Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 884540
NCBI-ProteinID: NP_220264
UniProt: O84750
Position
complement(866113..867387)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHVQLSILEKESRSGGLIVTEKQQGFSLNMGPKGFV
LAHDGQHTLHLIQSLGLADELLYSSPEAKNRFIHYNNKTRKVSPWTIFKQNLPLSFAKDF
FARPYKQDSSVEAFFKRHSSSKLRRNLLNPISIAIRAGHSHILSAQMAYPELTRREAQTG
SLLRSYLKDFPKEKRTGPYLATLRSGMGMLTQALHDKLPATWYFSAPVSKIRQLANGKIS
LSSPQGEITGDMLIYAGSVHDLPSCLEGIPETKLIKQTTSSWDLSCVSLGWHASFPIPHG
YGMLFADTPPLLGIVFNTEVFPQPERPNTIVSLLLEGRWHQEEAYAFSLAAISEYLQIYT
PPQAFSLFSPREGLPQHHVGFIQSRQRLLSKLPHNIKIVGQNFAGPGLNRATASAYKAIA
SLLS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgctctcattgttggctcaggtattgccggcctttctgccgcgtggtggcta
cacaaacgattccctcatgtgcagctgtctattctagaaaaagagtctcgatctggaggg
ctaattgtcacagagaaacaacaagggttttccctcaatatgggccctaaaggttttgtt
ttagctcatgatgggcaacacacccttcacctcattcagtctttaggcctagcagacgag
ctattatatagctctccagaggctaaaaaccgctttatccactataataataaaacccga
aaagtctcgccttggactattttcaaacaaaatctccctctctcttttgctaaggatttc
tttgcgcgtccttacaaacaagacagctccgtggaagccttctttaaaagacacagttct
tccaagcttagaagaaatcttttaaatcccattagcattgctattcgtgcaggacatagt
catatattgtctgcacagatggcttacccagaattaacacgaagagaagctcaaacagga
tcgttgttacgtagttatctcaaagattttcctaaagagaaacgcacaggcccttattta
gctaccttgcggtctgggatgggaatgctaacccaggctttgcatgataaattgcctgct
acctggtatttttctgcacccgtcagcaaaatccgtcagttggcgaatgggaaaatttct
ctttcatctcctcaaggagaaataacgggagatatgctcatttatgctgggtccgtgcac
gatctcccttcctgtctagaagggatccctgaaaccaagcttatcaagcaaacgacttca
tcttgggatctctcttgtgtatctttaggatggcatgcatccttccctatccctcatgga
tatggcatgcttttcgctgatacgcctcccttattagggatcgtgtttaatacggaagtg
ttccctcaacccgagcggcctaatacaatagtctctcttcttttagaaggtcgatggcac
caagaagaagcgtatgctttctcactagcagctatttctgagtacctgcaaatttacact
cctccccaagctttctcactattctctcctcgagagggacttccccaacaccatgttgga
tttatccaatcccgccaacgccttctatctaaacttcctcacaatataaaaattgtaggg
cagaattttgcaggtccaggtctcaaccgcgctacagcgtctgcttataaagctatagct
tctttactatcatga

DBGET integrated database retrieval system