KEGG   Chlamydia trachomatis RC-L2/55: CTRC55_03370Help
Entry
CTRC55_03370      CDS       T02771                                 

Definition
(GenBank) exodeoxyribonuclease V beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ctrc  Chlamydia trachomatis RC-L2/55
Pathway
ctrc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctrc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CTRC55_03370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ctrc03400]
    CTRC55_03370
Enzymes [BR:ctrc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTRC55_03370
DNA repair and recombination proteins [BR:ctrc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTRC55_03370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_12 AAA_30 PDDEXK_1 AAA_22 AAA_11 AAA_16 ResIII DEAD FWWh
Motif
Other DBs
NCBI-ProteinID: AGS04341
Position
complement(724173..727253)
Genome map
AA seq 1026 aa AA seqDB search
MSSFDIFSPTASVSGKFFLEASAGTGKTFTIEQVILRSLLEGSIEQTKNILVVTFTNAAT
NELKLRIQASLKQALSLFSQALSHPGTPLPPYISSSETKVKQLYMKIRNSLATLDEMNIF
TIHGFCRFTLEQHFPWIQPIQPSSIFSEPQTIQQYILDYLRKNLWDTVLSPKQYAFLSYH
HRATTQQTRHLIERLLQDYTSTPNLALSPLSITLQKLKAWVSCYQHLAPLSLEEMQAFSL
RFKQSDLSIERELPAFVQQFETNPYSLDMLFFPGMVQKFQEENRNKKKLSAPASPLDPFF
QDWIQLAHPFCQKEPIFHTLLKSVQQHLKTHCAQSYSHDESIATLESLLDHNDTVVSQLR
KQFQLVLIDEFQDTDKRQWQIFSKLFASPDYSGSLFLIGDPKQSIYEWRNADLPTYLQAK
HSFPKEAQLILDTNYRSTPELMQGLNHLFSLPTPFLETPQNILYHPLHSKGSSEISYSEF
SPIHFFSSEDIQEETLWISKTASYLRSAYSIPFGNMAVLVQDYPQALKLITHSTIPMAYC
KEKRIFDRTESPYLLILLLEALLYPENQQKIQAILMSRLFQLSSTEIHQHLKTFSSLFFT
LNRHLYHYSLLATFYKLMGENVLSQTIGETLLQTPLGDIIFQELEALCLYLDKTTENPHH
KLLHLINILITGKYDEELSFSSQSNDENMIKITTVHSSKGLEYDVVFCSCLNKAKEKTPS
VHMREMYVACTRAKKFLFIPFSPIEKRSLSTKKLSALANYANVTKHHSVPHLVETLTSSS
PELFSSSFQPPESSLTPDRERLPQQTYFSLPHLPSRTIHSFSSTVENLHFSEPIQELSPS
LLFPGGSLTGTLIHKLLESLAGNFAACFEEIFNKAQTLLKNTPLEGYESIIAEKIYTVFS
TTLPFSSGSFALRNIHPHNIRVEETFLLQEEGELWQGIVDLFFEHKGRFFIIDWKTSFLG
DETSCYSPDQLHLYIQRQGLDRQERLYRKAAKRFLHQFNSSLQVEMAFVFIRGLDDKGNG
FLQPGR
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttttgatattttttcaccaacagcttctgtttctgggaaatttttcttagaa
gcttccgcaggaactgggaaaacattcaccatagaacaagtgattcttcgctcgttatta
gaaggctcgatcgaacagacaaagaacattttggtggttacatttaccaacgcagctacc
aatgaattaaaactgcgtattcaagcaagcctcaaacaagcattgagtcttttctcccaa
gcactctctcatcccgggactcccttacctccctatatctcttcctcagaaacaaaagta
aaacagctttacatgaagatccgtaatagcctggccactttagatgaaatgaacatcttt
actattcatggattttgtcgttttacactggagcaacacttcccttggatacagcctatt
cagccgtcttccattttctcagagcctcaaaccatacaacagtatatcctagactactta
cgtaaaaatctttgggacacggttctctctcccaaacaatacgccttcttatcttatcat
caccgcgctactacccaacaaacacgccacctaatagagagactacttcaagattacact
tccacaccaaatttagcgctctcgcctctatcgataaccctgcaaaaactaaaagcttgg
gtctcctgctaccaacacttagctcctctctctctcgaggaaatgcaagctttctctctt
cgttttaaacaaagcgatctctctatcgagcgggaactccctgcttttgtgcaacaattc
gaaaccaatccttattctttggatatgctgtttttcccaggaatggtacagaagtttcag
gaggaaaaccgcaataagaaaaaattaagtgctccagcttctcctttagatccttttttc
caagattggatacagttagctcatcctttttgccaaaaagaacctattttccatacgcta
cttaaaagcgtgcaacaacatctgaaaactcactgcgcacaatcctattcccatgatgaa
agcatagctactttagaatctcttctagatcacaacgatactgtcgtctcacaactacgt
aaacaatttcagctagtcttgatcgatgaattccaagacactgacaaacgtcagtggcag
atcttttctaaactctttgcttctccagactattcaggatccctttttcttatcggagac
cctaaacagtctatttatgaatggagaaatgcagacctccccacatacttgcaagcaaaa
cactccttcccaaaagaagctcagcttattttagatacaaattaccgatccaccccagag
cttatgcaaggtctcaaccatttgttttctcttcccacaccgtttctagagactccacaa
aacattctgtatcaccctttacattctaaagggagctcggagatctcctactcagagttc
agtcctattcatttcttctcctcagaagacattcaagaagaaacgttatggatttctaaa
acagcttcttatcttcgatcagcgtattccattccatttggaaatatggctgttctagta
caagactatccacaggctctgaagctaatcactcacagcaccatccccatggcctactgc
aaagaaaaacgtatttttgatcgcacagaatccccctaccttctgattctactattggaa
gcccttctgtacccagagaatcaacaaaagattcaagccattttgatgagccggctattt
cagctttcctctacggagattcaccagcatcttaaaacgttttcttctttgtttttcact
ctgaatcgacatctctaccactattctctattagctaccttctataagctgatgggagaa
aacgttttatctcaaaccataggagaaacattattgcaaacccctcttggagatatcatt
ttccaagaattagaagcgctatgcttgtatcttgataaaactacagagaatccccatcac
aaactcttacatctcatcaatattctgattacagggaagtatgatgaagagctttctttc
tcgtcgcaatctaatgacgagaatatgataaaaattacgaccgttcactcttcaaaaggg
ctcgaatacgatgtagtattttgctcttgccttaacaaagcaaaagagaaaactccttct
gttcatatgcgagaaatgtatgtcgcatgcacaagagctaaaaaattcttatttattccg
ttttctcctatagagaaacgctcactaagcacaaaaaaactttctgctcttgctaactat
gctaatgttacaaaacatcatagcgttcctcatttagtagaaaccttgacttcctcatct
ccggaactattttcatcaagcttccaacctcctgaaagctctctaactccggatagagaa
cgtcttcctcaacaaacatacttttctcttccacatctcccttctcgaactattcactct
ttctcttctacggtagagaatcttcacttttcggaacctattcaagaactgtcaccttct
cttttatttcctggaggctctctaacgggaacgttgattcataaacttttagaatcatta
gcagggaattttgctgcttgttttgaagaaattttcaataaagctcagacattattgaaa
aacactcctttagaaggatacgagtctattattgcagaaaaaatctatacggtcttttca
acgactcttcctttttcttccggatcctttgctctcaggaatatacatcctcataacata
cgtgtagaggaaactttcttactacaagaagaaggagagttgtggcaaggaatcgtcgac
ttattttttgaacataagggtcgattttttatcatcgactggaaaacttctttcttagga
gatgaaacctcttgctattccccagatcaactccatctctatattcaacgtcaagggtta
gatagacaggagagattgtacagaaaagcagcgaaaaggttcctacaccaatttaattca
tcattgcaagtagaaatggccttcgtatttatccgaggcttggatgacaagggcaatgga
tttttgcaaccaggacgttaa

DBGET integrated database retrieval system