KEGG   Chlamydia trachomatis L1/1322/p2: L11322_00732Help
Entry
L11322_00732      CDS       T02557                                 

Definition
(GenBank) Phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctrp  Chlamydia trachomatis L1/1322/p2
Brite
KEGG Orthology (KO) [BR:ctrp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    L11322_00732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCP63628
Position
791072..792352
Genome map
AA seq 426 aa AA seqDB search
MWLLLVCVVVGGFYTAWNIGANDVANAVGPSVGAGALTLKQAVLIAAVFEFLGAVLLGDR
VIGTIESGLVAPSGHVLSSQDYVFGMAAALLATGVWLQIASFCGWPVSTTHAIVGAVLGF
GIILKEDAVIYWNSCGRVFVSWLASPIIGGYFAFLIFSFIRKAILYKKDPVSAMVRIAPF
LSAIIIFALGLVLILSGAVAPVISFSPALRIVCGLSLFAFFFTIWGIRFFKLAILPQEVL
PGTLLDRLLSKSTDYGRKYLIVERIFAYLQMIIACFMSFAHGSNDVANAIAPVAGIYRTL
YPQSYSSKVLLVFMSLGGLGLVCGLATWGWRVIDTIGKKITELTPSRGFSVGMSSAITIA
AASSLGFPISTTHVVVGSVLGIGFARGLRAINLRIIKDIVLSWFITVPAGAALSIVFFLL
LRALFC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgctgctggtttgtgtagttgtaggcggattctacacagcttggaacataggc
gctaatgatgtagcgaatgctgtgggaccaagtgtaggagccggtgcgctaactctaaag
caagccgttcttattgcagccgtctttgaatttcttggagcagtattgttaggagatcga
gttatcggcaccatagaaagtgggctggtagctccttccggtcatgtgttgtcatcccaa
gactatgtctttgggatggctgcagcgcttcttgccactggcgtgtggttgcagatcgct
tctttctgtggatggccagtgtcgacaacgcatgctattgtaggcgcagtgttgggcttc
ggtatcatccttaaagaggatgcggttatctactggaattcttgtggccgagtgtttgtc
agctggttagcatctcccattattgggggatactttgctttcctcatcttctcttttatt
cggaaagctatcctatataaaaaggatcccgtctctgctatggtgcgtatcgcgccattt
ttatcggcgatcattatttttgcattaggactagtccttatcctgagtggtgcagttgct
cccgttatttccttttctccagcgttgcgtattgtttgtggtttatctctttttgctttt
ttcttcacgatatggggaatacgcttctttaaacttgcgattcttcctcaggaagttctt
cctggaacattattagatcggttgttatccaaaagcaccgattatgggcgtaagtatctt
atagttgaacgcatttttgcttacttacagatgatcattgcatgctttatgtcttttgcg
catggatccaatgatgttgctaatgcgatcgctcctgttgcaggtatttaccggacactc
tatccccaaagttattcttcaaaagttctcttagtgtttatgtctttgggaggactaggt
ttagtttgcggattagcaacatggggctggcgtgtgattgatactatcgggaaaaaaatt
acagaattgactccatcacgaggcttttccgtaggaatgagttccgctatcactatagcg
gccgcttcctccttaggattccctatatctactacgcatgttgttgtaggatcggtattg
gggattgggttcgcaagaggtttacgagccattaatttgcggatcattaaagatattgtg
ctttcgtggtttattacagttcctgctggagcggcgctttctatcgtattttttttgtta
ctgcgcgcactattttgttaa

DBGET integrated database retrieval system