KEGG   Chlamydia trachomatis L2/25667R: L225667R_00224Help
Entry
L225667R_00224    CDS       T02559                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ctrr  Chlamydia trachomatis L2/25667R
Pathway
ctrr00130  Ubiquinone and other terpenoid-quinone biosynthesis
ctrr01100  Metabolic pathways
ctrr01110  Biosynthesis of secondary metabolites
ctrr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctrr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    L225667R_00224
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    L225667R_00224
Enzymes [BR:ctrr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     L225667R_00224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Glyco_transf_4 DUF4072
Motif
Other DBs
NCBI-ProteinID: CCP65811
Position
245583..246161
Genome map
AA seq 192 aa AA seqDB search
MKRYVVGISGASGIVLAVTLVSELARLGHHIDVIISPSAQKTLYYELDTKSFLSTIPQNF
HNQIVLHHISSIESSVSSGSNTVDATIIVPCSVATVAAISCGLADNLLRRVADVALKEKR
PLILVPREAPLSAIHLENLLKLAQNGAVILPPMPIWYFKPQTAEDIANDIVGKILAILQL
DSPLIKRWENPR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctacgtggtgggtatttccggagcatctggtattgtattggcagtcacatta
gtttctgaacttgccagattaggacatcatattgatgtcatcatatcgccatccgcacaa
aaaactctttattatgagctagataccaagtcttttttatctacaatccctcaaaatttc
cataaccagattgttcttcaccatatatcctctatagaaagttctgtatcatcaggctcg
aatactgtagatgcaactattatagttccttgcagcgtagctactgttgcagcaatctca
tgtggtttggccgataatcttttaagaagagtcgctgatgttgctctgaaagaaaaaaga
cctctgattcttgtaccacgagaggctcctctatccgcaatacatttagaaaacttactc
aagctagcacagaatggagctgtaatactccctcctatgcctatttggtactttaaacct
cagactgcagaagatatagccaatgatattgtgggaaaaatcttagccattttacagcta
gatagtccccttataaaaagatgggagaacccccgctaa

DBGET integrated database retrieval system