KEGG   Chlamydia trachomatis E/SotonE8: SOTONE8_00560Help
Entry
SOTONE8_00560     CDS       T02556                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ctrs  Chlamydia trachomatis E/SotonE8
Pathway
ctrs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctrs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SOTONE8_00560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctrs03011]
    SOTONE8_00560
Ribosome [BR:ctrs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SOTONE8_00560
  Bacteria
    SOTONE8_00560
  Archaea
    SOTONE8_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Bac_DNA_binding
Motif
Other DBs
NCBI-ProteinID: CCP56288
Position
complement(599986..600321)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAIANAESN
ENIKCENLCVLEVRVDAGPMFKRMKSKSRGGRAPILKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaggctcgtttagctgca
ggattgatgagaaaccgtagtgttgttgaagctcaacagcaactcagcttttctcagatg
aaggctggaagatgccttaaaaaagtgttggatagcgctattgcaaatgcagagtccaat
gaaaatataaaatgtgaaaatctttgcgttctagaagttcgggttgatgccggcccaatg
ttcaaaagaatgaagtctaagagtcgtgggggaagagccccgattttgaagcgcacgagt
catctaactgtgattgttggcgagagagggcagtag

DBGET integrated database retrieval system