KEGG   Chlamydia trachomatis E/SotonE8: SOTONE8_00741Help
Entry
SOTONE8_00741     CDS       T02556                                 

Definition
(GenBank) Phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctrs  Chlamydia trachomatis E/SotonE8
Brite
KEGG Orthology (KO) [BR:ctrs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SOTONE8_00741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCP56460
Position
800391..801671
Genome map
AA seq 426 aa AA seqDB search
MWLLLVCVVVGGFYTAWNIGANDVANAVGPSVGAGALTLKQAVLIAAVFEFLGAVLLGDR
VIGTIESGLVAPSGHVLSSQDYVFGMTAALLATGVWLQIASFCGWPVSTTHAIVGAVLGF
GIILKEDAVIYWNSCGRVFVSWLASPIIGGYFAFLIFSFIRKAILYKKDPVSAIVRIAPF
LSAIIIFALGLVLILSGAVAPVISFSPALRIVCGLSLFAFFFTIWGIRFFKLAILPQEVL
PGTLLDRLLSKSTDYGRKYLIVERIFAYLQMIIACFMSFAHGSNDVANAIAPVAGIYRTL
YPQSYSSKVLLVFMSLGGLGLVCGLATWGWRVIDTIGKKITELTPSRGFSVGMSSAITIA
AASSLGFPISTTHVVVGSVLGIGFARGLRAINLRIIKDIVLSWFITVPAGAALSIVFFLL
LRALFC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgctgctggtttgtgtagttgtaggcggattctacacagcttggaacataggc
gctaatgatgtagcgaatgctgtgggaccaagtgtaggagccggtgcgctaactctaaag
caagccgttcttattgcagccgtctttgaatttcttggagcagtattgttaggagatcga
gttatcggcaccatagaaagtgggctggtagctccttccggtcatgtgttgtcatcccaa
gactatgtctttgggatgactgcagcgcttcttgccactggcgtgtggttgcagatcgct
tctttctgtggatggccagtgtcgacaacgcatgctattgtaggcgcagtgttgggcttc
ggtatcatccttaaagaggatgcggttatctactggaattcttgtggccgagtgtttgtc
agctggttagcatctcccattattggaggatactttgctttcctcatcttctcttttatt
cggaaagctatcctatataaaaaggatcccgtctctgctatagtgcgtatcgcgccattt
ttatcggcgatcattatttttgcattaggattagtccttatcctgagtggtgcagttgct
cccgttatttccttttctccagcgttgcgtattgtttgcggtttatctctttttgctttt
ttcttcacgatatggggaatacgcttctttaaacttgcgattcttcctcaggaagttctt
cctggaacattattagatcggttgttatccaaaagcaccgattatgggcgtaagtatctt
atagttgaacgcatttttgcttacttacagatgatcattgcatgctttatgtcttttgcg
catggatccaatgatgttgctaatgcgatcgctcctgttgcaggtatttaccggacactc
tatccccaaagttattcttcaaaagttctcttagtgtttatgtctttgggaggactaggt
ttagtttgcggattagcaacatggggctggcgtgtgattgatactatcgggaaaaaaatt
acagaattgactccatcacgaggcttttccgtaggaatgagttccgctatcactatagcg
gccgcttcctccttaggattccctatatctactacgcatgttgttgtaggatcggtattg
gggattgggttcgcaagaggtttacgagccattaatttgcggatcattaaagatattgtg
ctttcgtggtttattacagttcctgctggagcggcgctttctatcgtattttttttgtta
ctgcgcgcactattttgttaa

DBGET integrated database retrieval system