KEGG   Chlamydia trachomatis L2b/UCH-2: L2BUCH2_00731Help
Entry
L2BUCH2_00731     CDS       T02548                                 

Definition
(GenBank) Phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctru  Chlamydia trachomatis L2b/UCH-2
Brite
KEGG Orthology (KO) [BR:ctru00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    L2BUCH2_00731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCP68074
Position
790484..791764
Genome map
AA seq 426 aa AA seqDB search
MWLLLVCVVVGGFYTAWNIGANDVANAVGPSVGAGALTLKQAVLIAAVFEFLGAVLLGDR
VIGTIESGLVAPSGHVLSSQDYVFGMAAALLATGVWLQIASFCGWPVSTTHAIVGAVLGF
GIILKEDAVIYWNSCGRVFVSWLASPIIGGYFAFLIFSFIRKAILYKKDPVSAMVRIAPF
LSAIIIFALGLVLILSGAVAPVISFSPALRIVCGLSLFAFFFTIWGIRFFKLAILPQEVL
PGTLLDRLLSKSTDYGRKYLIVERIFAYLQMIIACFMSFAHGSNDVANAIAPVAGIYRTL
YPQSYSSKVLLVFMSLGGLGLVCGLATWGWRVIDTIGKKITELTPSRGFSVGMSSAITIA
AASSLGFPISTTHVVVGSVLGIGFARGLRAINLRIIKDIVLSWFITVPAGAALSIVFFLL
LRALFC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgctgctggtttgtgtagttgtaggcggattctacacagcttggaacataggc
gctaatgatgtagcgaatgctgtgggaccaagtgtaggagccggtgcgctaactctaaag
caagccgttcttattgcagccgtctttgaatttcttggagcagtattgttaggagatcga
gttatcggcaccatagaaagtgggctggtagctccttccggtcatgtgttgtcatcccaa
gactatgtctttgggatggctgcagcgcttcttgccactggcgtgtggttgcagatcgct
tctttctgtggatggccagtgtcgacaacgcatgctattgtaggcgcagtgttgggcttc
ggtatcatccttaaagaggatgcggttatctactggaattcttgtggccgagtgtttgtc
agctggttagcatctcccattattggaggatactttgctttcctcatcttctcttttatt
cggaaagctatcctatataaaaaggatcccgtctctgctatggtgcgtatcgcgccattt
ttatcggcgatcattatttttgcattaggactagtccttatcctgagtggtgcagttgct
cccgttatttccttttctccagcgttgcgtattgtttgtggtttatctctttttgctttt
ttcttcacgatatggggaatacgcttctttaaacttgcgattcttcctcaggaagttctt
cctggaacattattagatcggttgttatccaaaagcaccgattatgggcgtaagtatctt
atagttgaacgcatttttgcttacttacagatgatcattgcatgctttatgtcttttgcg
catggatccaatgatgttgctaatgcgatcgctcctgttgcaggtatttaccggacactc
tatccccaaagttattcttcaaaagttctcttagtgtttatgtctttgggaggactaggt
ttagtttgcggattagcaacatggggctggcgtgtgattgatactatcgggaaaaaaatt
acagaattgactccatcacgaggcttttccgtaggaatgagttccgctatcactatagcg
gccgcttcctccttaggattccctatatctactacgcatgttgttgtaggatcggtattg
gggattgggttcgcaagaggtttacgagccattaatttgcggatcattaaagatattgtg
ctttcgtggtttattacagttcctgctggagcggcgctttctatcgtattttttttgtta
ctgcgcgcactattttgttaa

DBGET integrated database retrieval system