KEGG   Chlamydia trachomatis L2b/CV204: L2BCV204_00186Help
Entry
L2BCV204_00186    CDS       T02554                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ctrv  Chlamydia trachomatis L2b/CV204
Pathway
ctrv00030  Pentose phosphate pathway
ctrv00480  Glutathione metabolism
ctrv01100  Metabolic pathways
ctrv01110  Biosynthesis of secondary metabolites
ctrv01120  Microbial metabolism in diverse environments
ctrv01130  Biosynthesis of antibiotics
ctrv01200  Carbon metabolism
Module
ctrv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ctrv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ctrv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L2BCV204_00186
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L2BCV204_00186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctrv04147]
    L2BCV204_00186
Enzymes [BR:ctrv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     L2BCV204_00186
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     L2BCV204_00186
Exosome [BR:ctrv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   L2BCV204_00186
  Exosomal proteins of colorectal cancer cells
   L2BCV204_00186
  Exosomal proteins of bladder cancer cells
   L2BCV204_00186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N VWA_3
Motif
Other DBs
NCBI-ProteinID: CCP71115
Position
203392..204915
Genome map
AA seq 507 aa AA seqDB search
MEEIKDFGPTLPACPPCIVVIFGATGDLTSRKLFPALYNLTKEGRLSENFVCVGFARRPK
SHEQFREEMKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSALKAYLEQLDQQ
YGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVNLETAREL
QQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYIDHVQISVSESIGI
GSRGNFFEKSGMLRDMVQNHLTQLLCLLTMEPPSEFSSEEIKKEKIKILKKILPIREEDA
VRGQYGEGIVQDVSVLGYREEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPK
RTTDIAVIFKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVRPV
KMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLLEKWSQVHPIF
PNYMAGSLRPQEADELLSRDGKAWRPY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaattaaagactttggccccacattaccagcctgccctccctgtatcgtggtt
atttttggtgctacaggagacttgacctctaggaagctctttcctgctttatacaattta
acaaaggaaggacgtctatccgaaaactttgtttgtgttgggtttgctaggcgacctaag
tctcatgagcaatttcgcgaagaaatgaagcttgccgttcagcatttctctcactcatcg
gaaatagatattcgagtttgggaaagtctggaaaatagaatcttttaccaccaagctaat
ttttctgatgccgaaggctactctgctctgaaagcttatttggagcaactagatcaacaa
tacggaacacaagggaatcgtcttttttatttatcaacaccaccagattatttccaggaa
atcatccgcaatttaaatcggcatcagctattctatcatgaacaaggagcacaacagcct
tggtctcggctaattatagaaaagccttttggagttaatttagaaacagctcgagagctt
caacaatgcattgatgccaatattgatgaagagtcggtttatcgaatagaccattattta
ggaaaagaaacggttcaaaacattctgactattcgttttgctaatactctctttgagtct
tgctggaattctcagtacatagatcatgtgcaaatcagcgttagcgaatcaattggtata
ggatctcgagggaatttcttcgaaaagtcgggcatgctacgagacatggtacagaatcat
ttgacgcagctgctatgtctactgactatggaacctccttctgaattttcttccgaagaa
ataaaaaaagaaaaaattaaaattctaaagaaaattcttcctatccgcgaagaagatgct
gttcgtggccaatatggtgaagggattgtgcaagatgtttcagttctgggctatcgggag
gaagaaaatgtcgatccgaattcttcagtagaaacctacgttgcattaaaattatttatc
gacaatcctcgctggaaaggggttcccttttacttacaagcagggaaacgtcttcctaaa
agaacaacagatatcgctgtgatctttaaaaaatccagctacaatttattcaatgcagag
aattgtcctttgtgtccgttagaaaatgatttacttattattcgtattcaaccggatgaa
ggtgttgcgctacaatttaactgcaaggttccaggaacaaataagctcgtacgtcctgta
aaaatggacttccgttacgacagctattttaatactgttactcccgaagcttatgaacgg
ttactgtgcgactgtatccttggggacagaacgctattcactagcaatgaagaagtctta
gcatcttgggaactattttctcctctattagaaaaatggtctcaagtacaccctatattc
cctaactatatggccggatctttacgtcctcaagaagctgatgaactattatctagagat
ggaaaagcttggcggccctattaa

DBGET integrated database retrieval system