KEGG   Chlamydia trachomatis RC-L2(s)/3: CTRC3_04270Help
Entry
CTRC3_04270       CDS       T02772                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
ctrw  Chlamydia trachomatis RC-L2(s)/3
Pathway
ctrw00564  Glycerophospholipid metabolism
ctrw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctrw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTRC3_04270
Enzymes [BR:ctrw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     CTRC3_04270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF3966
Motif
Other DBs
NCBI-ProteinID: AGR98892
Position
938502..939110
Genome map
AA seq 202 aa AA seqDB search
MRVSLPNFLTVFRLFITPIFMILYLKGRWFGLSAAFLPYVLLFLLIITEITDAVDGYIAR
KFSQVTDLGKLLDPMADSVYRISLYLTFTQPPVNLPLILVFIFLARDSVISTLRTLCASR
GQVLAARMSGKLKAILQAISFFFIIFSMFLCAKGIISTDDLEFFSTVIVSLVAFYSICSG
VEYIWVNKSHLLQKNDSPDGES
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaagcttaccaaacttcctgacagtttttcgtctatttatcacaccgattttt
atgattctttacttaaaaggtcggtggttcgggttgtctgccgcattcctgccttatgtt
ctcctctttttgctgatcattacggaaatcacggatgctgtagatggatatattgcgaga
aagttttcccaggtaacagatctgggaaaacttctagatcccatggctgatagtgtatac
cgtatttcgctgtacctcacgttcacacaaccccccgtgaatcttcctctcatacttgtg
tttattttcttagctcgagattccgttattagcactttgcgtacgctgtgcgctagtagg
ggacaagtattagctgctaggatgagtgggaagttaaaagctattcttcaagctattagc
ttctttttcatcattttctcgatgttcctttgtgcaaaaggcattatctccacagacgat
ttagagtttttctcaacagtgatagtgtctttagtagccttttattctatttgctctgga
gttgagtatatttgggtgaataaaagtcacttattacagaaaaatgactcgccggatggc
gagtcatag

DBGET integrated database retrieval system