KEGG   Chlamydia trachomatis A/5291: A5291_00868Help
Entry
A5291_00868       CDS       T02563                                 

Definition
(GenBank) protease3
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ctrx  Chlamydia trachomatis A/5291
Brite
KEGG Orthology (KO) [BR:ctrx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ctrx01002]
    A5291_00868
Enzymes [BR:ctrx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     A5291_00868
Peptidases and inhibitors [BR:ctrx01002]
 Metallo peptidases
  Family M16: pitrilysin family
   A5291_00868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-ProteinID: CCP49103
Position
complement(944836..947706)
Genome map
AA seq 956 aa AA seqDB search
MDNHPPVINDPTNDPKNMKRSLSLLLLCIPSFLTACSKSFQTIRDENPLTILTPALADQK
IAKILCPNGLSIMIVSSPHAAESGAALVVKTGNNADPVEFPGLAHFTEHCVFLGNEKYPE
PSGFPAFLSTHGGIYNAFTYPDKTCFLFSVNNADLDNALDQFVHLFIQPLFRQEDLNKEV
HAVEQEFAMHPTKDSRRMHRIQQLIAPKNHPLKRFGCGNLSTLNSVTTQDMQTWFATHYS
PENMAAIVYTTAPLDTAVPYIASLFSEIPISAQYTPQKPFPKTQDTTALNKLFINKAVEP
SPQLAIYWHFYDAPQSLQGWAQSLISILSSEKENSLVALLKKEQLITEMEAELYSTSHNT
QDFEILYKLTNKGEREYQRVLQLTFAFLDYVRHERLPAYSLPEIQKINSLEYTYSTQTEL
FSTLSRMVPNFTSEPLATYPYRSLVYPEYSQEDEQTFATFLADPQQARYILSATLPSSWE
NADEFYDPIFDDTFYEKPLDFTPIQDSSSLGFAFPNPNKFIPQTVQLLSQKKQHEGFAFS
PQLTYDQNAITLYTCEDSFYTIPKMAMELRIRSPQIQRTDARSLVLRDLYSLLANETLIK
RYDDALKAGMTFAVSPGATGVDLSLLGYTETSPVLINALLSSLRDLPVEESLFLYYKDQL
SEQYQKNLIACPMRAGLNKLYSQILVDTVSLEDKLNTLNTLSYEEFANFTNKLLQELAVE
SLALGTLSTQDLSNLLSTLSNFAEASSPYAAPSYYPQRKPLSSTKLSFQYPLSGNGMLLL
EQNEDPHQYKDSVATSMLLSWIHNLYFSDLRTEQQLGYIVGSKYLEFAETPCGLFYIRSN
NYSPEELVHRTQLFIQKIATDPESAGLSEEIFEQLRETYIQSILLPSSTPLAMAKKLFSI
AFETKKQDFSRPDQKIAAARSMDYSYFKKYCEEFLSQKFGPEIQLLVYGANSSQEK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaccctcctgttatcaatgaccctaccaatgaccccaaaaatatgaagcgt
tccctatccctattacttctttgcattccttcttttctaactgcttgctcgaaatccttt
caaacgattcgagatgaaaaccctttgactattttgacccctgcattagcagatcaaaaa
attgctaaaattctatgccctaacggactctctatcatgattgtatcctcccctcatgct
gctgagtccggagccgctttagttgtcaaaacaggaaataatgcagatcctgtcgagttc
ccaggcttagcccattttacagaacactgtgtgttcctcgggaatgaaaaatatcccgag
ccctcaggatttcctgccttcctaagcacacatgggggtatctataacgcatttacttac
ccagataaaacctgcttcctattctccgtaaacaatgcagatttagataatgctctggat
cagtttgtacatctctttatccaacctctcttccgccaagaagatttaaacaaagaagtt
catgctgttgagcaagaatttgcgatgcatccaactaaagattctcgtcgtatgcatcgt
attcaacaacttatagctcctaaaaatcacccattaaaacgctttggctgcggcaatctc
tctaccctcaactccgtcactactcaagatatgcaaacatggtttgccactcactactct
ccagaaaatatggcagcaattgtttacactacagctccgttggacaccgcagtgccgtat
atcgcgtccctattctctgaaatccctatatctgcacagtacacaccacaaaaaccgttt
ccaaagacacaggatactacagctcttaataaactgttcatcaataaggctgtcgaacct
tctccacaactagctatttactggcatttttatgatgctccacagtccttacaaggatgg
gctcagtcactgatttctattttatctagtgaaaaagaaaatagtcttgttgctttactc
aaaaaagaacagctcattactgagatggaagcagaactttacagcacttctcataataca
caagattttgaaattctttataaactcaccaataagggggaacgcgaatatcaaagagtt
ttgcagctaacttttgcttttcttgattatgttcgtcatgaacgacttcctgcctactcc
ttgccagagatacagaaaatcaactctttagaatatacttacagcacgcaaaccgagtta
ttctcgacactatcacgaatggtccccaattttacttctgaaccattagcaacataccct
tatcgctctcttgtctatccagaatactcccaagaagatgaacaaacctttgctacattt
ttagcagaccctcaacaggcacgttatatcttatctgctaccctaccgagttcttgggag
aatgcagatgaattctatgatcccatctttgacgacactttctatgaaaaacccttagat
ttcacacctatacaggactcctcctccttaggatttgcttttccgaatcccaataaattt
attcctcaaacagtccaattattatctcaaaagaaacaacacgaagggtttgctttttct
ccgcagctgacctatgatcaaaatgcgatcactttatatacttgtgaagactctttctat
acgattcctaaaatggctatggagttgcgcatccgttctcctcaaattcaacgaacagat
gcgcgttctttagtattacgagacctatatagtctactagctaatgaaacattaataaaa
cgttatgacgatgctttaaaagctggaatgacttttgcagtatctcctggagcgacaggg
gttgatctttctcttttaggatatactgagacctctcctgttcttatcaatgctttgctg
tcttctttacgagatcttcctgtggaagaaagtctgtttctatattacaaagatcagcta
tcagaacaatatcagaagaatcttattgcctgccctatgagagctggtctcaataaacta
tactctcagattcttgttgataccgtttccttagaagataagctcaatactttaaacacc
ctctcctacgaagagtttgcgaacttcacgaataaactactccaagaactagctgtagaa
tctttagcactaggaacgctctcgactcaagatctctccaatttattatcgaccctctct
aactttgcagaagcttcgtctccttatgctgctcctagctattatcctcaaagaaaacct
ctctcttctacaaagctttcgttccaatatcctctctctggaaatggtatgctgctgctc
gaacaaaacgaagatccccatcaatataaggactctgtagctactagtatgttgttatct
tggatccataacttgtacttctctgatttacgtacagagcaacaacttgggtatatagta
ggttctaaatatctggaattcgcagaaactccttgtggacttttctatattcgatccaat
aactattctcctgaggagcttgtgcatagaacacaactctttatacaaaagattgctact
gatccagaatctgcaggcttgtccgaagagatctttgaacagcttcgagaaacatatatc
cagtccatattgcttccaagttccacacctttagctatggcgaaaaaattattctctata
gcttttgaaacgaaaaaacaggatttttctcgcccagaccaaaaaatagctgctgcccgt
tctatggattacagctatttcaaaaagtactgtgaagaatttttgagtcaaaagtttggc
ccagaaatccaactcctcgtctatggagccaactcgtctcaggaaaaataa

DBGET integrated database retrieval system