KEGG   Chlamydia trachomatis RC-L2(s)/46: CTRC46_03700Help
Entry
CTRC46_03700      CDS       T02773                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ctry  Chlamydia trachomatis RC-L2(s)/46
Pathway
ctry00564  Glycerophospholipid metabolism
ctry01100  Metabolic pathways
ctry01110  Biosynthesis of secondary metabolites
Module
ctry_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ctry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTRC46_03700
Enzymes [BR:ctry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CTRC46_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AGR95065
Position
798474..799379
Genome map
AA seq 301 aa AA seqDB search
MAAREMLYVNRETGKVEQERIICSSLVKFFIETRIGRALYSVLCKNSLFSRIVGWCQRLR
VTRYFIKPFVTKYRICIEESASPLHDYASFNDFFVRKLKPDARPICQGEDICVTPADGAY
LVFPSMADLSLFTIKNKPFSLESFLGDPQLAHQYAQGSMAIARLAPFDYHRFHFPIAGIA
EAPRRINGHLFSIHPLMLKRNFEVFTENKREITIITSKEFGEVAYVEVGALNVGSIHQTF
SPGSYVKKGAEKGFFAFGGSTVVLLFQPQRIIFDADLVGYSAQGLETRCRMGQSLGKRFS
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcgggaaatgttatatgttaatcgcgaaacagggaaggtagaacaggaacgt
atcatctgttcttctctggtaaagttttttattgaaacgagaatagggagagctctgtac
tctgttttatgtaagaatagcctgttttcccgtatcgtaggctggtgtcaaagactgcga
gtgacgcgatattttattaaacctttcgttacaaaatatcgtatttgcatagaagagagt
gcttctcctctgcacgactacgcgtcatttaatgatttttttgtacgaaaactcaaacca
gatgctcgacctatctgccagggagaggatatctgtgtgactcctgctgatggtgcctat
cttgttttcccttccatggcagatctatccttgtttaccattaaaaataagccgttttct
ttagaaagttttttaggggatccgcaattggctcaccaatatgcgcaagggagtatggca
atcgctcgattagctccttttgattaccatcgcttccactttcctatagcgggtattgct
gaggcaccgcgccgtatcaacggccatcttttttctattcatcctcttatgcttaagcgg
aatttcgaagtgtttacggagaataaacgcgaaattaccataattacgtcaaaagagttt
ggtgaggttgcctacgtggaagtaggggcgttaaatgtgggttctatccaccaaacgttt
tctcccggtagttatgtgaaaaaaggtgccgaaaaaggtttttttgcttttggaggatcg
actgttgttctattatttcagccccaacggattatctttgatgcagatctagttggttat
tctgctcagggtttagaaacccggtgtcgaatgggacaatcgttaggaaaacgtttctct
tcataa

DBGET integrated database retrieval system