KEGG   Chlamydia trachomatis A/7249: A7249_00783Help
Entry
A7249_00783       CDS       T02564                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ctrz  Chlamydia trachomatis A/7249
Pathway
ctrz00740  Riboflavin metabolism
ctrz00790  Folate biosynthesis
ctrz01100  Metabolic pathways
ctrz01110  Biosynthesis of secondary metabolites
Module
ctrz_M00840  Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctrz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A7249_00783
   00790 Folate biosynthesis
    A7249_00783
Enzymes [BR:ctrz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A7249_00783
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A7249_00783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: CCP49926
Position
845973..847247
Genome map
AA seq 424 aa AA seqDB search
MFTCEAGIASVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGI
VCASLSREQAKSLDLPAMVQDNQCAFKTAFTVSVDASSGVTTGVSASDRTRTVQLLADPA
ATAESFVRPGHVFPLISQPGGAVQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDHSMMRQ
QQVLAFAEQHDLTVITVDDLITYRYTYDSLVTKISSARLPTKYGDFSIHVYESIIDGTQH
FALVKGDIHEQEAVPVRVHSECLTGDILGSCRCDCGAQLDMAMRYIAEEGLGVIVYLRGQ
EGRGIGFGHKIRAYALQDLGYDTVDANLQLGFPIDAREYGMAAQVLKDLQLTSVRLITHN
PRKFFELQRLGIHVLDRIILPVSISTENEGYLRTKKERMGHWLDLPVLDDVEEEYETVER
MSCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatgtgaagctgggatagcgtcggtacagcaagcgataaaagatgtcgctgaa
gggaaatttgtcatagttattgatgcagcatctcgagaaaacgaaggagacttaatcctt
gccggagaaaaagtctctacagagaaaatgagttttcttttatcccacaccacaggtatt
gtctgtgcctcgctctctcgagagcaggcaaaatctttggacttgccagccatggttcaa
gacaaccaatgtgcgtttaaaaccgcttttaccgtttccgtagatgcttcttcaggagtg
actacaggtgtgtctgcgagtgatcgcaccagaactgtgcaattgttagctgatccggca
gcgacagccgagtcctttgttcgaccagggcatgttttccctttgatcagtcaacctggc
ggtgcagttcaacgtcctgggcacaccgaagctgctatggatctcatgcggcttgcaggt
atgcagccgtgtggtatttttgctgagttagtcaatccagaccactctatgatgcgacag
cagcaggtactcgcttttgctgagcaacatgatttaactgttattactgtggatgatttg
attacttatcgatatacctatgattccctcgttactaaaatctcatcggcgcgattacct
acgaaatacggagatttttcaatccatgtttatgagtcaatcatcgatgggacccagcat
tttgcattagttaaaggagatatccatgaacaagaagctgttccagtgcgtgtgcattcg
gaatgtctgactggggatattctggggtcttgtcgctgtgattgtggagcacagctagat
atggcgatgcggtacatagcagaagaggggctgggagttattgtgtatcttcgaggccaa
gaggggcgcggtatcggttttggacataagatccgcgcatatgcgcttcaagatttaggt
tatgatactgttgatgcgaatcttcaattagggttccctatagatgctcgtgaatatggc
atggctgctcaggttcttaaagaccttcagttgacaagcgtgagactgatcacccataat
ccaagaaaattttttgagttacagcggttaggaatacacgttcttgaccgaattattttg
cccgtcagtatttctaccgaaaatgaggggtatttgcgaacaaaaaaggaacgcatgggg
cattggttagatctgcccgttctggatgatgtggaggaagagtatgaaaccgttgaaagg
atgtcctgtcgctaa

DBGET integrated database retrieval system