KEGG   Chloroherpeton thalassium: Ctha_0913
Entry
Ctha_0913         CDS       T00726                                 
Name
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00230  Purine metabolism
cts01100  Metabolic pathways
cts01232  Nucleotide metabolism
Module
cts_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cts00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ctha_0913
Enzymes [BR:cts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ctha_0913
SSDB
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase AAA_18 AAA_16 AAA_22 CPT ABC_tran
Other DBs
NCBI-ProteinID: ACF13378
UniProt: B3QXA4
Position
complement(1090538..1091125)
AA seq 195 aa
MEKGTTLGKLIVFSAPSGAGKSTIANRILAEVPNLYFSVSATTRKMRPGEQEGHEYFFLS
KEEFEQKIAEKRFIEYEQFFGNYYGTLKDKTDERLEKGENLLFDLDVKGAVNLKKLYGEH
AVLIFIKPPSLEALKERLLKRSSDSIAEIENRLERAAFELSFANQFDFEIVNDELETAIQ
SIKAFILKSIQQPSK
NT seq 588 nt   +upstreamnt  +downstreamnt
atggaaaaaggaacaaccttaggaaaactcatcgtcttttcggcgccgtctggtgcgggt
aaatcaacgatcgccaatcgcattttagcggaagttccaaatttgtatttttccgtttca
gccacaacacgaaaaatgcgtccaggtgaacaagaaggccatgagtattttttcctgagc
aaagaagaattcgagcagaaaatcgcggaaaagcggtttatcgagtatgagcagtttttt
ggaaattattatggcacgctgaaagataaaactgatgagcgcttggaaaaaggggagaac
ttgctgtttgaccttgacgtcaaaggagccgtaaatcttaaaaaactttatggcgaacac
gctgtgctgattttcatcaaaccgcccagccttgaagcgttgaaagaacgcctgctcaaa
cgaagttccgactcaatcgcggaaatagaaaaccggctggaacgcgccgcatttgaactt
tcgtttgcgaatcagtttgattttgaaatcgtaaatgatgagcttgaaaccgcgattcaa
agtatcaaagcgtttatcttgaagtcaattcaacaaccgtcaaaataa

DBGET integrated database retrieval system