KEGG   Chloroherpeton thalassium: Ctha_0339Help
Entry
Ctha_0339         CDS       T00726                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
cts  Chloroherpeton thalassium
Brite
KEGG Orthology (KO) [BR:cts00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Ctha_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACF12810
UniProt: B3QU12
Position
386557..386985
Genome map
AA seq 142 aa AA seqDB search
MTSDICTVSIDSLEDISQRKLQPPYKYAHAYTITIHNISTYTVQIKSRMWIVKDGDMKDR
VVEGDGIVGHKPILMPGDTFTYTSYHVMLNRFGSALGKYFGTYAYVPEFEQESLFDDDEF
EGDEFEVNIPEIQLIHKLRPGA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgacatttgtacggttagcatcgacagtcttgaagatatcagccagcgcaag
cttcagccgccttataagtatgctcatgcctacacgattaccattcacaatatttcaacc
tacactgttcaaatcaaatccagaatgtggatcgttaaagatggcgacatgaaagacaga
gtggttgaaggcgatggcattgttgggcacaaacccattttgatgcctggcgatacattt
acttataccagctatcatgttatgctaaaccgttttggcagcgctcttggaaaatatttt
ggcacgtatgcgtatgtccctgaatttgaacaggaatcgctctttgatgatgacgagttt
gaaggagatgagtttgaagtaaacattccagaaattcaactgatccacaaactgaggcca
ggcgcatag

DBGET integrated database retrieval system