KEGG   Chloroherpeton thalassium: Ctha_0784Help
Entry
Ctha_0784         CDS       T00726                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00010  Glycolysis / Gluconeogenesis
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01120  Microbial metabolism in diverse environments
cts01130  Biosynthesis of antibiotics
cts01200  Carbon metabolism
cts01230  Biosynthesis of amino acids
Module
cts_M00002  Glycolysis, core module involving three-carbon compounds
cts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_0784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cts04147]
    Ctha_0784
Enzymes [BR:cts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Ctha_0784
Exosome [BR:cts04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ctha_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACF13252
UniProt: B3QWD9
Position
complement(932081..933274)
Genome map
AA seq 397 aa AA seqDB search
MKKKTVDDVSFAGKRVLMRVDFNVPLKDGAVTDDIRIRGALPSIQKVLSDGGCVILMSHL
GRPKGKPVAEMSLKPAADRLAELLGKPVQMAPDCIGDEVKNMAAAMKAGDVLMLENLRFH
KEEEANDPEFAKSLASLGEVFVNDAFGTAHRAHASTEGVTNYVAESVAGYLIGKELTYLG
EATANPVRPFVAILGGAKISGKIDVLENLLGKVDTVLVGGAMVFTFFKAQGYNIGKSLVE
DDKLELAKSILEKAKTSGVKFLLPTDVVLADKFDQDANTKIATIDSIEDDWMGLDIGPET
ANCFREEVVNAKTVIWNGPMGVFEMEKFAKGTMAVAQALADATKQGAITVIGGGDSAAAI
AVAGLEDSVTHVSTGGGASLEFLEGKELPGIAALSNA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaaccgttgatgacgtctcctttgctggaaaacgcgtgctgatgcgcgtt
gattttaatgtgccgcttaaagacggcgcagtcaccgacgatattcgcattcgtggtgca
cttccatctattcagaaagtgctgagcgatggtggatgtgtaattctcatgtcgcacctt
ggccgtccaaagggcaaaccggttgctgaaatgtcgttgaagcctgctgctgatcggctg
gctgaattgcttggaaaaccggttcaaatggcgccggattgcattggtgatgaagtcaag
aacatggctgcagccatgaaagccggtgacgtgctcatgctggaaaatcttcgtttccac
aaagaagaagaagcaaacgatcctgagtttgccaaaagcttggcatcgcttggtgaggtg
tttgtcaacgatgcgtttggaacagcacaccgcgctcatgcgtctacggaaggcgttaca
aactatgtggccgaatcggttgctggatatttgattggaaaagaattgacgtatttggga
gaagccaccgccaatccggttcgtccgtttgtcgcgattttgggtggcgcaaagatttct
ggcaaaattgatgtgctcgaaaacctgctcggaaaagtagacacggtgctggttggcggc
gcaatggttttcaccttctttaaagcacaaggctacaatattggaaaatcgttggttgaa
gacgataagttggagctggcaaaatcgattttggaaaaagcgaaaacttcaggtgtgaag
ttcttgttgccaaccgatgtggttttggccgacaaattcgatcaggatgccaataccaaa
attgcaaccatcgatagcattgaagacgattggatgggacttgatattgggccagaaacg
gccaactgcttccgtgaggaagtcgtcaatgccaagaccgttatttggaatggtccgatg
ggcgtatttgaaatggaaaaatttgcaaaaggcacaatggctgtggcgcaagctctcgcc
gatgcaacaaaacaaggtgcgattacggttatagggggtggggactccgcggctgccatt
gcagtagccggccttgaggatagcgttacgcatgtttcaaccggcggcggcgccagtctg
gaattccttgaaggaaaagaacttccaggcattgcagcgcttagcaacgcttaa

DBGET integrated database retrieval system