KEGG   Chloroherpeton thalassium: Ctha_0869Help
Entry
Ctha_0869         CDS       T00726                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00260  Glycine, serine and threonine metabolism
cts00750  Vitamin B6 metabolism
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01120  Microbial metabolism in diverse environments
cts01230  Biosynthesis of amino acids
Module
cts_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ctha_0869
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ctha_0869
Enzymes [BR:cts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ctha_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N VirD1
Motif
Other DBs
NCBI-ProteinID: ACF13337
UniProt: B3QWX3
Position
complement(1040305..1041621)
Genome map
AA seq 438 aa AA seqDB search
MKYYSTSRISPATSMKTAVLQGLAPDRGLYMPEWIPCFSSGKLDELKDASFSELAFEIAK
PFLGNELDESRLQEITEQSFTFKVPLVRLNNQTYILELFEGPTLAFKDFGARFMARLTGA
FAEEDNKLITVLVATSGDTGSAVAYGFKGVPNTRVVILYPSGKVSRLQEQQLTTAGGNVT
ALEVSGDFDACQKLVKEAFADAELRSSLTLTSANSINIARLLPQSFYYAYASLQLKKKNP
DAEIVFTVPSGNFGNLTAGIFAKKMGFPIKRFIAASNKNDSVPRYLETGSYEPHATIETL
STAMDVGNPSNFARMLDIYDSSVRAMSDEITGYSVSDAETRETMRVIYDEMGYLLDPHTA
VGVTALGKERAKNQSEKEISVVLSTAHPAKFVETVRETLEFDMQIPERLANVLNLTKQST
PIANDFQALKSLLLSLPC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacagcaccagccgaatctcgccggccacttccatgaagacggcggttttg
caaggacttgccccggatagagggctttacatgcccgaatggattccctgtttttcgtcg
ggcaaattggatgaactcaaagacgcttcgttttccgagcttgcgttcgaaatcgccaag
ccatttcttggcaacgaattggacgagtcgcgccttcaggaaatcacggagcaaagtttt
acgtttaaagtcccgctcgttcggctcaataatcaaacctacattttagaactctttgaa
ggcccaacgcttgcgtttaaagatttcggcgctcgatttatggctcgcctaacgggtgca
tttgccgaagaagacaataaactgattactgttttggtcgccacttccggcgacacggga
agcgccgttgcgtatggcttcaaaggtgtgccgaacacgcgcgtcgtgattttgtatccg
tcgggcaaagtgagccgtttgcaggagcaacagctgacaaccgccggcggcaatgtcacc
gcgctggaagtttcgggcgatttcgacgcttgccaaaaattggtgaaagaagccttcgcc
gatgctgaattgcgctcaagcctaacgctcacttcagccaattccatcaacattgcgcgt
cttttgccgcaatcgttttactatgcctatgcgtcgcttcagctaaaaaagaaaaatccc
gatgcggaaatcgtctttaccgtgccgagcggaaattttggaaacctaacggctggtatt
tttgccaaaaagatgggttttcctatcaagcgatttattgcagcgtccaataaaaacgac
agcgtcccgcgctatcttgaaactggcagctacgaaccgcacgccaccatcgagacactt
tccaccgcgatggatgtgggaaatccgagcaactttgcccgcatgttagatatttacgat
agctctgttcgcgccatgagcgatgaaattaccggatattcggtttctgatgcggaaacg
cgcgaaaccatgcgcgtcatttatgacgaaatgggctatttgctcgatccacatacggct
gtcggcgtcactgcgcttggaaaagagcgagcaaaaaatcagtcggaaaaagaaatttcg
gtggtgctttcgacggcgcatccggccaagtttgtggaaacagttagggaaacgctagaa
tttgatatgcagattcctgaacggcttgcgaatgtcttaaacctaaccaaacaatccacg
ccgattgcaaacgattttcaggcgctgaaatcgctcttgctttcgcttccatgctaa

DBGET integrated database retrieval system