KEGG   Chloroherpeton thalassium: Ctha_1941Help
Entry
Ctha_1941         CDS       T00726                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00770  Pantothenate and CoA biosynthesis
cts01100  Metabolic pathways
Module
cts_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cts00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ctha_1941
Enzymes [BR:cts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Ctha_1941
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Ctha_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP DUF3215 PspC
Motif
Other DBs
NCBI-ProteinID: ACF14395
UniProt: B3QUE6
Position
2312767..2314020
Genome map
AA seq 417 aa AA seqDB search
MKLLGKKILLGVSGGIAAYKIPNLVRLLKKNGAEVQVLMTASAAEFASPLALATVSENKV
LTEIFPDSAHEAKAEWTCHISLGEWADLFVIAPATANTIGKLASGLCDDMLSAAFLTLRP
AKPRLIFPSMDGEMYFAKAVQRNLAQLKADGCEVIEPETGSLASGLTGMGRMPDPETIFD
RIVKTYDSNEDAELCRAFDGKNVVVTAGATREKIDDVRFISNYSSGKMGFALAASAAKLG
AKVTLITGKTALQTPQGVQRIDVESAREMLVAAEAFFTACDMFIAAAAVADYRPASPHEG
KIKKSENVFEIQLVKNPDILQLFGTQKSSKQVAIGFALEAQNPMENAKEKLAKKNLDLIV
LNSASEPGAGFEVDTNVVTLIGKDGTLEKLPLMSKLEVAKVILKKSSFFFGKDMLLS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcttggaaaaaaaatcttgctcggtgtgtcgggaggcattgccgcttataaa
attccgaatttagttcggttgttgaaaaagaatggggcggaagttcaggtgctgatgacg
gcatccgctgctgagtttgccagtccgctggcgcttgcgacggtttcggaaaataaagtg
ctgacggaaattttccccgattcggcgcacgaagccaaagcagaatggacttgccatatt
tcgctcggtgagtgggcagatctgtttgtcattgcgcccgccacggccaacacgattggc
aaactggcttcgggactttgtgacgacatgctttcggcggctttccttacgcttcgtccg
gcaaaaccgcgactcattttcccctcgatggacggcgaaatgtattttgccaaagccgtg
cagcgcaatttagctcagctcaaagccgacggctgtgaggttatagagccggaaacgggt
tcgctggcttctggcctaacgggcatgggtagaatgcccgaccctgaaaccatttttgat
cgcattgtgaaaacgtatgattcgaatgaagatgctgaattgtgccgcgcttttgatgga
aaaaatgtggtggtgacagccggcgcgacacgcgaaaaaatcgacgacgtgcgatttatt
tcgaattattcctccggcaaaatgggttttgcattggccgcgtcggcggcaaaacttggc
gcaaaggtgacgctgatcactggcaaaaccgcgctgcaaacgccgcaaggggttcagcga
atcgatgtagaaagcgcgcgtgaaatgctcgttgcagcagaagcgttttttaccgcatgc
gacatgttcattgccgccgctgccgttgccgactatcgaccggccagcccgcacgaaggc
aaaatcaaaaagtcagaaaacgtttttgaaattcaattggtcaaaaatccagatattctt
caactttttggcacacaaaaaagctcgaagcaagtggccattggctttgcgctggaagca
caaaatccgatggaaaatgccaaggaaaaattggccaaaaagaatctggatttaattgtt
ctcaattcggccagcgagccaggcgcgggtttcgaagtcgataccaacgtggtaacttta
atcggaaaagacggtactttagaaaaattgccgttaatgagtaagctggaagtcgcgaag
gtgattctgaaaaaatcaagttttttcttcggaaaagatatgttattaagctaa

DBGET integrated database retrieval system