KEGG   Chloroherpeton thalassium: Ctha_2159Help
Entry
Ctha_2159         CDS       T00726                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00010  Glycolysis / Gluconeogenesis
cts00260  Glycine, serine and threonine metabolism
cts00680  Methane metabolism
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01120  Microbial metabolism in diverse environments
cts01130  Biosynthesis of antibiotics
cts01200  Carbon metabolism
cts01230  Biosynthesis of amino acids
Module
cts_M00002  Glycolysis, core module involving three-carbon compounds
cts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_2159
  Energy metabolism
   00680 Methane metabolism
    Ctha_2159
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ctha_2159
Enzymes [BR:cts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ctha_2159
Membrane trafficking [BR:cts04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ctha_2159
Exosome [BR:cts04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ctha_2159
  Exosomal proteins of melanoma cells
   Ctha_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACF14610
UniProt: B3QVL0
Position
2576037..2576786
Genome map
AA seq 249 aa AA seqDB search
MIKLVLLRHGESVWNKENRFTGWKDVDLTEKGVQEAKRAGEFMKKEGLDFDIAYTSVLKR
AIRTLNLALNEMDLQWIPVNKTWRLNERHYGALQGLNKSETAEKFGEEQVLIWRRSYDTP
PPALEKSDERYPGHDPRYKDLTEAELPLTECLKDTVERFLPYWHETIAPTIKSGKRVIIA
AHGNSLRSLVKYLDNISDEDIVGLNIPTGMPLVYELDDDMKPIKNYYLGDPDDVAKAMAS
VANQGKAKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattagttctcttgcggcacggcgaaagcgtgtggaacaaggaaaatcgcttt
accggctggaaagacgtcgacctaaccgaaaaaggcgttcaggaagccaaacgcgccggc
gaatttatgaaaaaagaaggcttggattttgacattgcctacacatccgttctgaaacgc
gccattcgcacgctcaaccttgcgctcaatgaaatggatttgcagtggattccggtcaat
aaaacttggcgcctcaacgaacgccactacggtgcgcttcaaggattgaacaaatccgag
accgccgaaaagttcggtgaagagcaagtgctgatttggcgtagaagttacgatacaccg
ccgccagctttggaaaaatccgacgaacgctatccgggacacgacccgcgctacaaagac
ctcaccgaagccgaacttcctttgaccgaatgcttgaaagacaccgtcgagcggtttttg
ccgtactggcacgaaaccattgcgccgaccatcaagtccggcaagcgcgtcatcattgcc
gcacatggcaattcgcttcgttcgttggtaaaatatttggacaacatttccgacgaagac
attgtcggcctgaacattccgaccggcatgccgctcgtctatgaattggacgacgacatg
aagccgattaaaaactactacttgggcgacccggacgatgtcgcaaaagcgatggcttcg
gttgcgaatcaaggtaaagcgaaagcttaa

DBGET integrated database retrieval system