KEGG   Comamonas thiooxydans: CtCNB1_0090Help
Entry
CtCNB1_0090       CDS       T01109                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00020  Citrate cycle (TCA cycle)
ctt00620  Pyruvate metabolism
ctt00650  Butanoate metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
Module
ctt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_0090
   00620 Pyruvate metabolism
    CtCNB1_0090
   00650 Butanoate metabolism
    CtCNB1_0090
Enzymes [BR:ctt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CtCNB1_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: ACY30836
UniProt: A0A454XXA9
Position
100077..101591
Genome map
AA seq 504 aa AA seqDB search
MSIADRVRYPEFLSRVMTAEEAAALIPHGVNVGMSGFTGAGYPKALPQAIAARAKAEHAQ
GKPYKINVWTGASTAAECDGVMAEAHALGQRLPFNTDPIARKAVNSGEIDFIDMHLSHVA
QHAWFGFLGHMNIAVIEVLGVTADGLLIPSTAVGNNKTWLEIADKVILEVNTKPPARMEG
MHDIYYGTAIPPRRMPINMTHADDRIGDAYLKVDPAKVVAVVETHKGDRDNVFATPDENS
QKIAGYIIDFLAHEMKMGRLPKEMLPIQSGVGNVANAVLAGLLTGPFENLLGFTEVLQDG
MLDLLRAGKMSKASATSISLSAAAYKDFEDNIDFYRERIILRPQEISNHPELVRRLGIIA
MNSMIEADIYGNINSTHVMGTGMMNGIGGSGDFARNGYLSFFVTPSVAKDGKISCIVPMC
SHVDHTEHDTQIIVTEQGLADLRGLSPKQRAQVIIDRCAHPDYRAQLQDYFDRSRQQGAQ
HTPHILTEALSWHQRFMDKGDMRG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgcagatcgcgtacgttacccagaattcctctcgcgcgtcatgacggccgaa
gaggccgccgccctgattccccacggtgtcaatgtcggcatgagcggctttaccggagcc
ggttatcccaaggcattgccacaggccatagcggcccgtgccaaggcagagcatgcccag
ggcaagccctacaagatcaatgtctggaccggcgcgtccaccgccgccgaatgcgacggc
gtgatggccgaagcccacgcactgggtcagcgcctgcccttcaacaccgatcccatcgcg
cgcaaggccgtgaactcgggtgagatcgacttcatcgacatgcacctgtcccatgtggcg
cagcatgcctggttcggctttctgggccatatgaacatcgccgtgatcgaggtgctgggc
gtgaccgccgacggtctgctgatcccgtcgacggccgtgggcaacaacaagacctggctg
gagatcgccgacaaggtgattctggaagtcaacaccaagccgcccgcccggatggagggc
atgcacgacatctactacggcacggccatcccgccgcgccgcatgcccatcaacatgacg
catgccgatgaccgcatcggcgatgcctacctgaaggtggaccccgccaaggtcgtggcc
gtggtcgagacccacaagggcgaccgcgacaatgtgtttgccacaccggacgaaaactcc
cagaaaatagccggctacatcatcgacttcctggcccacgagatgaagatgggccgcctg
ccaaaggaaatgctgcccatccagtcgggtgtgggcaatgtggccaatgccgtgctggca
ggcttgctgaccggcccgttcgagaacctgctgggctttaccgaagtgctgcaggacggc
atgctggatctgctgcgcgcgggcaagatgagcaaggcctcggccacctccatctcgctg
tctgctgcggcctacaaggacttcgaggacaacatcgacttctaccgcgagcgcatcatc
ctgcgcccgcaggaaatctccaaccaccccgagctggtgcgccgcctgggcatcatcgcc
atgaactcgatgatcgaggccgacatctacggcaacatcaactccacccatgtcatgggc
acgggcatgatgaacggcatcggcggatcgggcgactttgcacgtaacggctatctgtcc
ttcttcgtcacgccctcggtggccaaggacggcaagatcagctgcatcgtgcccatgtgc
tcgcatgtggaccacaccgagcatgacacccagatcatcgtcaccgagcagggtctggcc
gatctgcgtggcctgtcgcccaagcagcgtgcgcaagtcatcatcgacaggtgtgcccat
ccggactaccgcgcccagttgcaggattatttcgaccgctcgcgccagcagggtgcgcag
cacacgccgcatatcctgaccgaggcactgtcctggcatcagcgcttcatggacaagggc
gatatgcggggctga

DBGET integrated database retrieval system