KEGG   Comamonas thiooxydans: CtCNB1_0894Help
Entry
CtCNB1_0894       CDS       T01109                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctt  Comamonas thiooxydans
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CtCNB1_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ACY31640
UniProt: A0A454XTT6
Position
1000306..1001316
Genome map
AA seq 336 aa AA seqDB search
MEPVQAALWVVILLVVLALLFDFMNGFHDAANSIATVVSTGVLKPTQAVAFAAFFNVVAV
FVFHLSVAATVGKGIVQPGIVDTHVVFGALVGAITWNVITWIYGIPSSSSHALIGGIVGA
VIAKAGAGALIASGIWKTVAFIFVSPVLGFLLGSLMMVLVAWIFRRASPNRVDKWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIIWLLLIATGYANAGDAEPPMWTIVSCYLAIGLGTMFGG
WRIVKTMGQKITKLKPVGGFCAESGGALTLFFATFLGVPVSTTHTITGAIVGVGSTQRAS
AVRWGVAGNIVWAWILTIPASAFVASIAYWVSLQLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagccggtacaggcagccctctgggttgtgattttgctggtggtgctcgccttgctg
ttcgatttcatgaacggctttcacgacgctgccaattcgattgccaccgtggtttccacg
ggggttctcaagcctactcaggccgtggcatttgccgcgttcttcaacgttgtcgcggtt
ttcgtcttccacctcagtgtggcggcaaccgtgggcaagggtattgttcagccgggcatt
gttgacacccatgtcgtgttcggcgctctggtgggtgccatcacctggaacgtcatcacc
tggatctacggcattcccagcagctcctcgcatgccctgattggcggtatcgtgggtgcg
gtgattgccaaggccggtgcaggtgcgctgatcgccagcggcatctggaagactgtggcc
ttcatctttgtctctcccgtgctgggctttctgctgggctcgctgatgatggttctggta
gcctggattttccgccgtgccagccccaatcgcgtggacaagtggttccgccgtctgcaa
ttggtttctgccggtgcctacagcctgggtcacggcggcaacgatgcgcaaaagaccatc
ggtatcatctggttgctgctgattgccacgggctatgccaatgccggtgatgccgagcct
cccatgtggaccatcgtcagctgctacctggccatcggcctgggcaccatgtttggcggc
tggcgcatcgtcaagaccatgggccagaagatcaccaagctcaaacccgtcggtggcttc
tgcgccgaatccggtggtgctctgactttgttctttgccaccttcctgggcgttccggtc
tcgaccacacacaccattaccggtgccatcgtgggcgtgggttccacgcagcgcgcgagt
gccgtgcgctggggcgtggcaggcaatatcgtctgggcatggattctgacgattccggcc
agcgcctttgtggcatccattgcctactgggtcagcctgcaactgtattga

DBGET integrated database retrieval system