KEGG   Comamonas testosteroni CNB-2: CtCNB1_1060Help
Entry
CtCNB1_1060       CDS       T01109                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00010  Glycolysis / Gluconeogenesis
ctt00051  Fructose and mannose metabolism
ctt00562  Inositol phosphate metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
ctt01230  Biosynthesis of amino acids
Module
ctt_M00002  Glycolysis, core module involving three-carbon compounds
ctt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_1060
   00051 Fructose and mannose metabolism
    CtCNB1_1060
   00562 Inositol phosphate metabolism
    CtCNB1_1060
Enzymes [BR:ctt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CtCNB1_1060
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CtCNB1_1060
  Exosomal proteins of bladder cancer cells
   CtCNB1_1060
  Exosomal proteins of melanoma cells
   CtCNB1_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Tricho_coat
Motif
Other DBs
NCBI-ProteinID: ACY31806
UniProt: D0J1R0
Position
1191544..1192299
Genome map
AA seq 251 aa AA seqDB search
MGNMKQKLIVGNWKMNGSLAANAALLQAIKQGLPAGNKAGVAVAAPAPYLAQVQAELAGT
SIGVGAQDVSQHEQGAFTGETSAVMLKEFGVRYALVGHSERRQYHGETDVVVAAKAQAAL
AKGITPIVCVGETLAEREAGQTEAVVKRQLAAVIHQVGHCVSELVVAYEPVWAIGTGKTA
TPEQAQQVHAVLRAQLAAASDKADRVPLLYGGSMNAGNAAQLLAQADIDGGLIGGAALKA
PDFLTIIAAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaacatgaagcaaaaactcattgttggcaactggaagatgaacggcagcctggct
gccaatgctgctttgctgcaggccatcaagcagggcttgcctgctggcaacaaggcgggc
gtggccgtggctgctcctgcgccctatctggctcaagtccaggcggaacttgcgggtact
tccattggggtgggcgcacaggatgtgtcccagcacgagcagggcgcattcacgggcgaa
acttctgctgtcatgctcaaggagttcggcgtgcgctatgcgctggtcggtcactccgag
cgtcgtcagtatcatggcgagaccgatgtcgtggttgctgccaaggcccaggctgcgctg
gccaagggcatcacgcccatcgtctgcgtgggcgagaccctggcggagcgtgaagcgggt
cagaccgaggccgtggtcaagcgtcagctggcagccgtgattcatcaggtcggccactgc
gtgagcgagctggttgtggcctatgagcctgtctgggccataggcaccggcaagactgcc
actcccgagcaggcccagcaggtgcatgccgtgctgcgggcgcagctggcggcggccagc
gacaaggctgatcgcgtgcccctgctttatggcggcagcatgaatgcaggcaatgcggcg
cagctgctggctcaggccgatattgacggtggcctgatcggtggtgcggctctcaaggcc
ccggatttcctcaccattattgcggcagcgcaataa

DBGET integrated database retrieval system