KEGG   Comamonas testosteroni CNB-2: CtCNB1_1397Help
Entry
CtCNB1_1397       CDS       T01109                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00010  Glycolysis / Gluconeogenesis
ctt00620  Pyruvate metabolism
ctt00640  Propanoate metabolism
ctt00680  Methane metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_1397
   00620 Pyruvate metabolism
    CtCNB1_1397
   00640 Propanoate metabolism
    CtCNB1_1397
  Energy metabolism
   00680 Methane metabolism
    CtCNB1_1397
Enzymes [BR:ctt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CtCNB1_1397
Lipid biosynthesis proteins [BR:ctt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CtCNB1_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACY32143
UniProt: D0J3V0
Position
1581411..1583405
Genome map
AA seq 664 aa AA seqDB search
MSAATSTIESVLVENRVFPPPADFAAKARISGMAQYQALCDEAERDYEGYWARLARENVQ
WTKPFTQVLDQSNPPFYKWFADGELNASANCLDKHMGTPVENKTAIIFEADGGEVTKVTY
KELLARVSQFANALKARGVQKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKA
VQERIVDVGASLVVTSNYQMRGGKELPLKAIVDDALALGGCEAVKSVLVYERTATACNMV
AGRDISFTEALAGQSTECEAVPVNAEHPLFILYTSGSTGKPKGVQHATGGYVLWAKQTFE
WTFDARDSDVFWCTADIGWITGHSYVAYGPLAAGATQIVFEGVPTFPNAGRFWQMIERHQ
CSIFYTAPTAIRSLIKAADSDPSVHPKNWNLSSLRLLGSVGEPINPEAWMWYHKHVGGER
CPIVDTFWQTENGGHMITPLPGATPLVPGSCTLPLPGITAAIVDEAGNEIPNGAGGILVV
KKPWPSMIRTIWGDPERFKKSYFPEELKGYYLAGDGAVRSEDRGYFRITGRIDDVLNVSG
HRMGTMEIESALVAKTDLVAEAAVVGRPDDLTGEAICAFVVLKRGKPTGEEARQIATELR
NWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQL
SETN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcgacatcaaccatcgaatccgtgctggtggaaaaccgtgtgttcccgccc
cctgcggatttcgccgccaaggcccgcatctcgggcatggcgcaataccaggccctgtgc
gatgaagccgagcgcgactatgaaggctattgggcacggctggcccgcgagaacgtgcag
tggaccaagcccttcacccaggtgctggaccagagcaacccgcctttctataaatggttt
gccgacggcgagctcaacgccagcgccaactgcctggacaagcacatgggcacgcccgtg
gagaacaagacggccatcatctttgaagcagacggcggcgaggtcaccaaggtcacttac
aaagagttgctcgcccgcgtgagccagttcgccaatgcgctcaaggcgcgcggcgtgcaa
aagggcgatcgcgtgctgatctacatgcccatgactatcgagggtgtggtggccatgcag
gcctgcgcacgcatcggcgccacgcattccgtggtgttcggcggcttctcggccaaggcc
gtacaggagcgcattgtggacgtgggtgccagtctggtcgtcacttccaactaccagatg
cgcggcggcaaggagttgccgctcaaggccatcgtcgacgacgcgcttgcgctgggcggc
tgcgaagccgtcaagagcgtgttggtctatgagcgcacggccactgcctgcaatatggtc
gcgggccgcgacatcagcttcaccgaggcattggccggccagtccaccgagtgcgaagcc
gtgcccgtcaatgccgagcacccgctcttcatcctctacaccagcggctccaccggcaag
cccaagggcgtgcagcatgccaccggcggctatgtgctgtgggccaagcagaccttcgaa
tggactttcgatgccagggacagcgatgtcttctggtgcacggccgatatcggctggatc
accggccacagctatgtggcctatggcccgctggcggccggtgccacgcagatcgtcttc
gaaggcgtgccgaccttccccaatgcgggccgcttctggcagatgatagagcgccaccag
tgcagcatcttctacacggcacccacggccatacgctcgctgatcaaggcggcggactcc
gaccccagcgtccacccgaagaactggaatctgtccagcctgcgtctgctgggctcggtg
ggcgagcccatcaaccccgaagcctggatgtggtatcacaagcatgtgggcggcgagcgc
tgccccatcgtagacaccttctggcagaccgagaacggcggccacatgatcacaccgctg
cccggtgccacacctctggtgcccggctcctgcaccctgcctctgcccggcatcacggcg
gccatcgtcgacgaggccggcaatgagatccccaatggcgccggcggcatcctggtggtg
aagaagccctggccctcgatgattcgcaccatctggggcgaccccgagcgcttcaagaag
agctacttccccgaagagctcaagggctactacctggccggcgacggcgccgtgcgcagc
gaggatcgcggctatttccgcatcacaggccgtatcgacgatgtgctcaatgtctcgggc
caccgtatgggcaccatggaaatcgagtcggccctggtggccaagaccgatctggtggcc
gaggccgccgtggtcggccgtcccgacgacctgaccggcgaagccatctgcgcctttgtg
gtgctcaagcgcggcaagcccacgggcgaggaagccaggcagattgcgaccgagctgcgc
aactgggtggccaaggagatcggcccgattgccaagcccaaggacatccgcttcggcgac
aacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctcgctggccaag
ggagaagcgattacccaggacaccagcactctggagaatcccgcgatcctcgagcaattg
tcggagaccaattga

DBGET integrated database retrieval system