KEGG   Comamonas testosteroni CNB-2: CtCNB1_1622Help
Entry
CtCNB1_1622       CDS       T01109                                 

Definition
(GenBank) putative Cytochrome c
  KO
K08738  cytochrome c
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACY32368
UniProt: D0J4W0
Position
complement(1837621..1838019)
Genome map
AA seq 132 aa AA seqDB search
MNTERWLLLGMLSFAATVHAAPDKLPGEQIYTRCAACHALAYDRVGPHHCGLLGRRAGTV
PGFAYSNAMKNSGFIWDEKTLDRFLTQPMKVLPGTTMTYAGIPDPKERSDLIAYLKQAND
SRECHSLRALPH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaacggtggctgctgcttggcatgctgtcgttcgcggcgacagtgcatgca
gcacctgacaaacttcctggcgagcagatatacacccgctgtgcggcctgccatgcgctg
gcatatgaccgagtgggaccgcatcattgcggcctgttgggacggcgtgcaggcacggtt
cccggctttgcttactcgaatgccatgaagaattccggcttcatctgggacgaaaaaaca
ctcgaccgtttcctgacccagcccatgaaggtgctaccaggtacgacaatgacgtacgcc
ggaatccctgaccccaaggagcgtagcgacttgattgcctacctcaagcaagccaacgat
tcacgagagtgtcattcccttcgagcactcccgcattga

DBGET integrated database retrieval system