KEGG   Comamonas testosteroni CNB-2: CtCNB1_2351Help
Entry
CtCNB1_2351       CDS       T01109                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00071  Fatty acid degradation
ctt00072  Synthesis and degradation of ketone bodies
ctt00280  Valine, leucine and isoleucine degradation
ctt00310  Lysine degradation
ctt00362  Benzoate degradation
ctt00380  Tryptophan metabolism
ctt00620  Pyruvate metabolism
ctt00630  Glyoxylate and dicarboxylate metabolism
ctt00640  Propanoate metabolism
ctt00650  Butanoate metabolism
ctt00900  Terpenoid backbone biosynthesis
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
ctt01212  Fatty acid metabolism
ctt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CtCNB1_2351
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_2351
   00640 Propanoate metabolism
    CtCNB1_2351
   00650 Butanoate metabolism
    CtCNB1_2351
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_2351
   00072 Synthesis and degradation of ketone bodies
    CtCNB1_2351
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CtCNB1_2351
   00310 Lysine degradation
    CtCNB1_2351
   00380 Tryptophan metabolism
    CtCNB1_2351
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CtCNB1_2351
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_2351
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CtCNB1_2351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctt04147]
    CtCNB1_2351
Enzymes [BR:ctt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CtCNB1_2351
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CtCNB1_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACY33097
UniProt: D0IWT8
Position
complement(2687271..2688452)
Genome map
AA seq 393 aa AA seqDB search
MEDIVIVSAVRTAVGKFGGSLAKIPATQLGATVISEALARAKVGKDQVGEVIMGQVLTAA
AGQNPARQAMMAAGIAKETPALTINAVCGSGLKAVMLAAQAVATGDSEIVVAGGQENMSL
SPHAVPNSRDGQRMGDWKMVDTMIVDGLWDVYNQYHMGITAENVAKEKNVSRAQQDALAL
ASQQKAAAAQDAGKFKDEIVPVSIPQRKGDPIVFDSDEYVNRKTNADVLATLKPAFDKAG
SVTAGNASGLNDGAAAVVVMTAAKAKALGLKPLAKIVSYATSGLAPEVMGLGPVYATRKA
LDRAGWKAADVDLFELNEAFAAQACAVNHDLGIDTAKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQRSGAKKGLAGLCIGGGMGVAMAVEAC
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgttatcgtttccgccgtgcgtacggcggtcggcaagttcggcggctct
ctggccaagattcctgcaacccagctgggtgcgaccgtgatttccgaggctctggctcgt
gccaaggtgggcaaggaccaggtcggtgaagtcatcatgggccaggtgttgacggcggcg
gccggtcagaatcctgcgcgtcaggccatgatggcggccggcattgccaaggagacacct
gcgctgacgatcaatgccgtctgcggctccggccttaaggcggtgatgctggcagctcag
gccgtggcaacgggagacagcgaaatcgtggttgccggaggccaggaaaacatgagcctg
tcgccccatgccgtgcccaattcgcgtgacggccagcgcatgggtgactggaagatggtg
gacaccatgatcgtggacggtctgtgggatgtctacaaccaataccacatgggcatcact
gccgagaacgtggccaaggaaaagaacgtcagccgcgcgcagcaggatgcgctggcgctg
gccagccagcaaaaggctgcggccgcgcaggatgctggcaagttcaaggacgaaatcgtt
cccgtgagcattccccagcgcaagggtgaccccatcgtgttcgacagtgacgaatacgtc
aaccgcaagaccaatgccgatgtgctggccaccctcaagcccgctttcgacaaggcaggt
tcggtgacggccggcaatgcctcgggtctgaacgacggcgccgccgccgtggtggtgatg
acggcggccaaggccaaggcactgggcctcaagcctctggccaagatcgtgtcttacgcc
accagcggcctggccccagaggtcatgggtctgggtcctgtctatgccacgcgcaaggcg
ctggatcgcgccggctggaaggctgccgatgtggatctgttcgaactcaacgaagccttt
gccgcacaggcctgcgcggtgaatcacgatctgggcattgacaccgccaaggtcaacgtc
aacggtggtgccattgccatcggtcaccccattggtgcatcgggctgccgcattctggtg
acgctgctgcatgaaatgcagcgcagcggtgccaagaagggcctggccggtctgtgcatc
ggcggtggcatgggtgttgctatggctgtggaagcctgctga

DBGET integrated database retrieval system