KEGG   Comamonas testosteroni CNB-2: CtCNB1_3391Help
Entry
CtCNB1_3391       CDS       T01109                                 

Definition
(GenBank) succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00020  Citrate cycle (TCA cycle)
ctt00190  Oxidative phosphorylation
ctt00650  Butanoate metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
Module
ctt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ctt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_3391
   00650 Butanoate metabolism
    CtCNB1_3391
  Energy metabolism
   00190 Oxidative phosphorylation
    CtCNB1_3391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACY34137
UniProt: D0J3E3
Position
3836766..3837131
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGTRDFLAQRSTAVLMALYTVVLLVRFLTVGGPVGYEQWAGIFAP
QWMKFLTLALFVALGWHAWIGVRDIWMDYVKPVGLRLALQVVTIVWLVGCISWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgttgtcggtgcgcactatggcacccgcgac
tttctggctcaacgctctaccgccgtcctgatggcgctgtacaccgttgtgctgctggtg
cgctttctgacagtcggcggccccgtgggctacgagcagtgggccggcatttttgctccc
cagtggatgaagtttctgaccctggccctcttcgtggctctgggctggcatgcctggatc
ggcgtgcgtgacatctggatggactacgtcaagcccgtgggcctgcgccttgcactgcaa
gtggtcaccattgtctggctggtcggctgcatcagctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system