KEGG   Comamonas thiooxydans: CtCNB1_3850Help
Entry
CtCNB1_3850       CDS       T01109                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00450  Selenocompound metabolism
ctt00970  Aminoacyl-tRNA biosynthesis
ctt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CtCNB1_3850
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CtCNB1_3850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctt01007]
    CtCNB1_3850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctt03016]
    CtCNB1_3850
Enzymes [BR:ctt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CtCNB1_3850
Amino acid related enzymes [BR:ctt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CtCNB1_3850
Transfer RNA biogenesis [BR:ctt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CtCNB1_3850
 Prokaryotic type
   Other AARSs
    CtCNB1_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACY34596
UniProt: D0J5U4
Position
4332226..4334373
Genome map
AA seq 715 aa AA seqDB search
MTARKLFVTTALPYANGNFHIGHIMEYIQADTWVRAQRMQGNAVNFVGADDAHGAPIMIA
AEKAGKTPQQFVADIAAGRKQYLDGFHIAFDNWSNTDSAENHELSKQIYLDLKKAGFIET
RTIEQFFDPEKNMFLPDRFIKGECPRCHAKDQYGDNCEVCSSVYAPTDLINPFSALSGAT
PVMKSSEHFFFKLSDPRAVEFLTEWTQNGKHVQPEVAAKIKEWFGVRTNPDGSTSEGLDD
WDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKELLNRRGEDYDAYMADPDLEQYH
FIGKDIITFHTLFWPAMLKFSGRKTPTRICVHGFMTVNNGEKMSKSRGTGLDPLKYLSLK
MNPEWLRYYLGAKLNGKNEDIDFNPEDFMLRVNSDLIGKYVNIASRAAGFISKRFDGRLG
QVSEDGQALLAALREQQAAIVAAYEARDSARAAREIMLLCDKVNSYVDANKPWELAKKEG
MDARLHDVCTTCIEAFRILTIYLSPILPGVAAEVARFLIVPPESFADVVKPLGAGHQIGI
YQHLMQRVDPKQLEALFEAPAGQAAPATEPAKAEKKAAKKAEPVIDPNAPGGEPLAETIS
IDDFAKVDLRIARILECKTVEGSTKLLQLTLDVGEKDENGQPRTRNVFSGISSMYQPEQL
QGKLTVMVANLAPRKMKFGLSEGMVLAASHADEKAHPGIYVLEPFPGAMPGMRIH
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcaaactattcgtcaccaccgccctgccgtacgccaacggcaacttccac
atcggccacatcatggaatacatccaggccgacacctgggtgcgtgcgcagcgaatgcag
ggcaatgcggtcaacttcgtgggtgccgacgatgcccacggcgcgcccatcatgattgcc
gccgaaaaggccggcaagacgccccagcagttcgtggccgacatcgccgccggccgcaag
cagtacctcgacggcttccacatcgccttcgacaactggagcaacaccgacagcgccgaa
aaccacgagctgtccaagcagatctatctggacctgaagaaggctggcttcatcgaaacc
cgcaccatcgagcagttcttcgatcccgagaagaacatgttcctgcccgaccgcttcatc
aagggcgaatgcccgcgctgccacgccaaggaccagtacggcgacaactgcgaagtctgc
agctcggtctacgcgcccaccgacctcatcaacccgttctcggccctgtcgggtgccacg
ccggtgatgaagtcgtccgagcatttcttcttcaagctctccgacccgcgcgccgtggag
ttcctgaccgaatggacccagaacggcaagcatgtgcagcccgaagtggcggccaagatc
aaggaatggttcggcgtgcgcaccaaccccgacggatcgaccagcgaaggcctggacgac
tgggacatcagccgcgacgcgccctatttcggcatcgagattcccgatgcgccgggcaag
tatttctatgtctggctggatgcgcccgtgggctatctggcatcgctcaaggaactgctc
aaccgacgcggcgaagactacgacgcctatatggccgaccccgacctggagcagtaccac
ttcatcggcaaggacatcatcaccttccacaccctgttctggcctgcgatgctcaagttc
agcggccgcaagacgccgaccaggatctgcgtgcacggcttcatgaccgtgaacaacggc
gagaagatgagcaagagccgcggcaccggcctcgacccgctcaaatacctgtcgctcaag
atgaaccccgagtggctgcgctactacctgggcgccaagctcaacggcaagaacgaagac
atcgacttcaatcccgaagacttcatgctgcgcgtcaactccgatctgatcggcaagtac
gtgaacattgcttcgcgcgccgcaggcttcatcagcaagcgctttgacggcaggctgggt
caggtaagcgaagacggccaggccctgctggccgcgctgcgcgaacagcaagccgccatc
gtcgccgcctacgaggcccgcgacagcgcccgcgccgcgcgcgagatcatgctgctgtgc
gacaaggtcaacagctatgtggacgccaacaagccctgggaactggccaagaaggaaggc
atggatgcgcgcctgcacgatgtgtgcacgacctgcatcgaagccttccgcatcctgacc
atctacctgagccccatcctgcccggcgtggccgccgaagtggcccgattcctcatcgtg
ccgcccgagagctttgccgacgtggtcaagcccctgggcgcaggccaccagatcggcatc
taccagcatctgatgcagcgcgtcgatcccaagcagctcgaagccctgttcgaagcgccc
gccggccaggccgcccccgccaccgaacccgccaaggccgagaagaaggctgccaagaag
gccgagcccgtgatcgaccccaatgcccccggcggcgagccgctggccgagaccatcagc
atcgacgactttgccaaggtcgatctgcgcatcgccaggattctggaatgcaagacggtg
gaaggctcgaccaagctgctgcagctgacgctggacgtgggcgagaaggacgaaaacggc
cagcccaggacccgcaatgtgttcagcggcatcagcagcatgtaccagcctgagcagctg
cagggcaagctgacggtgatggtggccaatctggctccgcgcaagatgaagttcggcctg
tccgaaggcatggtgctggccgccagccatgccgacgagaaagcccaccctggcatctat
gtgctggagcccttccccggcgccatgcccggcatgcggattcattga

DBGET integrated database retrieval system