KEGG   Comamonas testosteroni CNB-2: CtCNB1_4178Help
Entry
CtCNB1_4178       CDS       T01109                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00220  Arginine biosynthesis
ctt00330  Arginine and proline metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01130  Biosynthesis of antibiotics
ctt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CtCNB1_4178
   00330 Arginine and proline metabolism
    CtCNB1_4178
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CtCNB1_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACY34924
UniProt: D0J7J2
Position
4695246..4696199
Genome map
AA seq 317 aa AA seqDB search
MACTSSTLIGLPTDIGASRLGAAMGPDALRVAQLGPALQRLGVQVSDLGNLSGPANPRGA
RDAQGLRNLAECLSWNRIAHDAVLQVLQQHRLPILLGGDHTLATGSISAVARHCRATGKQ
LRVLWLDAHSDCNTPESSPTGNLHGMPVSSLCGLGPAELASLSGTTPALPASSFCQIGLR
SVDESEKHMIRELGLEVYDMRAIDELGMREVMRRALVSLLGRNDRDIHLHLSFDVDFLDP
DIAPGTGTPVRGGPTYREAQLCMEMIADSGRLASLDIVELNPALDLRNQTAELVVDLVQS
LFGQSTLMREPRGVLQC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcacatcgtccacactgatcggtctgcccaccgatatcggtgcctcgcgcctt
ggcgcggccatggggcccgatgccctgcgtgtggcccagctcggtccggcgctgcaacgg
ctgggtgtgcaggtcagcgatctgggcaatctgagcggccccgccaacccgcgtggcgcg
cgcgatgcccagggtctgcgcaatctggccgaatgcctgagctggaaccggatcgcccat
gacgcggtgctgcaggtgctgcagcaacaccggctgcccatactgctgggtggcgaccat
acgctggccacaggctccatcagcgccgtggcccgccattgccgcgccacgggcaagcag
ctgcgcgtgctctggctggatgcccactcggattgcaacacccccgaaagttcgcccacg
ggcaatctgcacggcatgccggtttcaagcctctgcggactgggaccggcggaactggcc
tcgctgtcgggcacgactcccgccctgcctgcctcatcgttctgccagatcggcctgcgc
agcgtggacgagagcgaaaagcacatgatccgagagctggggctggaggtctacgacatg
cgggccattgacgagctgggcatgcgtgaagtgatgcgccgcgccctggtcagcctgctg
ggacgcaacgacagagacatccatctgcatctgagctttgacgtggactttctcgatcct
gacattgctcccggcaccggcacgccggtacgcggcggccccacctaccgcgaggcccag
ctgtgcatggaaatgattgccgactccggccgtcttgcctcgctggacattgtggagctc
aacccggcgctggacctgcgcaaccagacggcggagctggtggtggatctggtgcaaagc
ctgttcgggcagagcacgctgatgcgcgagcctcgcggcgtgctgcaatgctga

DBGET integrated database retrieval system