KEGG   Comamonas thiooxydans: CtCNB1_4266Help
Entry
CtCNB1_4266       CDS       T01109                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00010  Glycolysis / Gluconeogenesis
ctt00071  Fatty acid degradation
ctt00350  Tyrosine metabolism
ctt00625  Chloroalkane and chloroalkene degradation
ctt00626  Naphthalene degradation
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_4266
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_4266
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CtCNB1_4266
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CtCNB1_4266
   00626 Naphthalene degradation
    CtCNB1_4266
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CtCNB1_4266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: ACY35012
UniProt: D0J8A8
Position
4792775..4793809
Genome map
AA seq 344 aa AA seqDB search
MSLPQTMKAAVVRSFGKPLTIEEMPVPRPTDDQILVKIAASGVCHTDLHAAEGDWPVKPH
PPFIPGHEGVGHVAAVGKNVKHVKEGDRVGVPWLHSACGFCRHCIGGWETLCESQTNTGY
SVNGGFADYALADPNYVGHLPSNVSFIDVAPVLCAGVTVYKGLKVTDAKPGDWVVISGIG
GLGHMAVQYAKAMGFNVAAVDIDDSKLALARQLGATVTVNAMNTDPAAYLQREIEGAHGV
LVTAVSPKAFEQALGMVRRGGTISLNGLPPGDFPLPIFSMVLKGITVRGSIVGTRLDLQE
SLDFAAQGKVKATVSTDKLENINDIFARMHEGKIEGRVVLDIAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaccccagaccatgaaagccgccgtggtgcgttccttcgggaagccgctcacg
atcgaagaaatgccggtgccccgaccgacagacgatcagatcctggtcaagatcgctgct
tccggcgtctgccacaccgatctgcatgcggccgaaggcgactggcccgtcaagcctcat
ccgcccttcattcccggccacgagggtgtgggccatgtggctgcggtgggcaagaacgtc
aagcatgtcaaggaaggcgatcgcgtgggcgtgccctggctgcacagcgcctgcggcttc
tgccgccactgcataggcggctgggaaaccttgtgcgaatctcagaccaataccggctat
tcggtcaatggcggctttgccgattacgcactggccgaccccaactatgtgggccatctg
ccgtccaatgtgagctttatcgacgtcgctcccgtgctctgcgccggggtcacggtgtac
aagggcctgaaggtcaccgacgccaagcccggcgactgggtggtgatttccggcatcggc
ggcctgggccatatggccgtgcaatatgccaaggccatgggcttcaatgtcgcggcggtc
gacatcgacgacagcaagctcgcgctggcgcgccagctgggcgcaaccgtcaccgtcaac
gccatgaacaccgacccggcggcctatctgcaaagagagattgaaggcgcccacggcgtg
ctggtcacggccgtgtcgcccaaggctttcgagcaggctctgggcatggtgcgccgcggc
ggcacgatttcgctcaacggcctgccacctggcgattttccgctgccgattttctccatg
gtgctcaagggcatcacggtgcgcggctccatcgtcggcacgcgcctggacctgcaggag
tcgctggactttgccgctcagggcaaggtcaaggccaccgtatccaccgacaagctggaa
aacatcaacgacatctttgcccgcatgcacgaaggcaagatcgaaggccgcgtggtgctg
gacatcgccgcctga

DBGET integrated database retrieval system