KEGG   Comamonas thiooxydans: CtCNB1_4404Help
Entry
CtCNB1_4404       CDS       T01109                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00061  Fatty acid biosynthesis
ctt00071  Fatty acid degradation
ctt01100  Metabolic pathways
ctt01212  Fatty acid metabolism
ctt02024  Quorum sensing
Module
ctt_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CtCNB1_4404
   00071 Fatty acid degradation
    CtCNB1_4404
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CtCNB1_4404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ctt01004]
    CtCNB1_4404
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctt04147]
    CtCNB1_4404
Enzymes [BR:ctt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CtCNB1_4404
Lipid biosynthesis proteins [BR:ctt01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CtCNB1_4404
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CtCNB1_4404
  Exosomal proteins of breast cancer cells
   CtCNB1_4404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACY35150
UniProt: D0IUZ3
Position
complement(4950359..4951957)
Genome map
AA seq 532 aa AA seqDB search
MAESEILIPLHEALRRNARQHPERDAYIWYGQHISWRQVDEASDAVAAHLQQLGVKPGEP
VALFMNNCPQYIVAHYAVQKIGAIVCPCGPLNKEHELEYQLNDLQARVIIAADVLLPVVD
KVRGSTALQHVLAVRYGDWLPARATLPLPAELQAPVQPLPANVTSFWDLMHSGARPAPVD
VDMDEVALMTYTSGTTGLPKGAMLSFGAAAYKTAGASLVTGVGAEDVLLAVAPLYHIAGM
SMGVNMPVHSGATCVLLHRFDPLAVAQALERYRVSWWYSIAPMNVALMQVPGVEKMDFSA
LRRNTVTSFGITYTEDLAQQWRRFAPNAISSEAAYGLSETHTMDTFMPGDAIRWGTHGKP
APGNEIRVIDPETGAPLAAGEVGEIIIRGPGNFKGYWNKPEATAKTLKDGWVHTGDMGKF
DADGYLTFIGRFKEMIKVSGYSVFPEEVEAILIKHPAIAQAAVIGVADAQKGEVVRAFIV
RKPGQSLEADGLLAWSKENMASYKAPREVRFIDALPATGAGKVLRRLLRDIP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatccgaaatcctcattcccctacatgaggccttgcgccgcaatgcgcgtcag
catcccgagcgcgatgcctatatctggtacggacagcacatcagctggcgccaggtggat
gaggccagcgatgccgtggccgcgcatctgcagcaactgggcgtgaagcccggcgagccc
gtcgccctgttcatgaacaactgcccgcagtacatcgttgcgcattacgcggtgcagaag
atcggagccatcgtctgcccctgcgggccgctgaacaaggagcatgaactcgaataccag
ctcaacgatctgcaggcccgggtcatcatcgcggccgatgtgctgctgcccgtggtcgac
aaggtgcgcggcagcaccgcgctgcagcatgtgctggccgtgcgctacggcgactggctg
cccgccagagccacgctgcccctgcctgccgaactgcaggcccccgtgcagccgctgccc
gccaatgtgacgtccttctgggatctcatgcacagcggtgccaggcccgcgcctgtcgat
gtggacatggacgaggtggcgctgatgacctatacctcgggcaccacgggtctgcccaag
ggtgccatgctgagcttcggcgcggccgcgtacaagaccgccggcgcgtccctggtgacc
ggggtcggcgccgaggatgtcctgctggccgtggcgccgctttatcacatcgccggcatg
tccatgggggtgaacatgcccgtgcattcgggggcgacctgcgtgctgctgcatcgcttc
gatccgctggccgtggcgcaggcactggagcgctatcgcgtcagctggtggtacagcatc
gcgcccatgaatgtggcgctgatgcaggtgcccggcgtggagaagatggatttcagcgcg
ctgcgccgcaacaccgtcaccagcttcggcatcacctataccgaggatctggcgcagcaa
tggcgcaggttcgcacccaacgccatctccagcgaggcggcctacggcctgtccgaaacc
cataccatggataccttcatgccgggcgatgccatccgctggggcacccatggcaagccc
gcgccgggcaacgaaatccgggtgatagatccagagaccggcgcaccgctggccgcaggc
gaggtgggcgagatcatcattcgcggcccgggcaacttcaagggctactggaacaagccc
gaggccacggccaagacgctcaaggacggttgggtgcataccggcgatatgggcaaattc
gatgcggacggctatctgacctttatcggccgcttcaaggaaatgatcaaggtctcgggc
tacagcgtgttccccgaggaggtggaggcgattctgatcaagcatccggccatcgcccag
gcggccgtgatcggtgttgccgacgctcagaaaggcgaggtcgtgcgcgccttcatcgtg
cgcaagccggggcagagcctggaagcggacgggctgctggcctggagcaaggaaaacatg
gccagctacaaggctccgcgcgaggtgcgtttcatcgatgccttgccggccaccggggct
ggcaaggtattgcgccgcctgctcagggacatcccctga

DBGET integrated database retrieval system