KEGG   Comamonas thiooxydans: CtCNB1_4591Help
Entry
CtCNB1_4591       CDS       T01109                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00040  Pentose and glucuronate interconversions
ctt00053  Ascorbate and aldarate metabolism
ctt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CtCNB1_4591
   00053 Ascorbate and aldarate metabolism
    CtCNB1_4591
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CtCNB1_4591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SepF
Motif
Other DBs
NCBI-ProteinID: ACY35337
UniProt: D0IWA1
Position
complement(5140634..5142220)
Genome map
AA seq 528 aa AA seqDB search
MQITGEMLIGASSVRGTEGQQQAFDPRMDQFIATPTFGMGGQAEVDRAAQLAAQAFDPYR
QLSLAKRAEFLELIADNIMALGDALIERAMAESGLPLVRLQGERGRTVGQLRLFAKVVRD
GRFMSPAIDHAQPERTPLPRADLRLAKMALGPVAVFGASNFPLAFSVAGGDTASALAAGA
PVVVKAHSAHLGTSEMVGRAIQKAVRDLGLPEGVFSLLMGAGRKLGEALVAHPAIKAVGF
TGSRQGGLALMRIANARPEPIPVYAEMSSINPVFLMPAALAARAESIGRGFADSLTMGAG
QFCTNPGMVVVIGDRNVQRFIDAASQALATKPAQTMLTPGIHQAFDAGVAKVGGAEGVEK
VAQGQPADGLHNAAQAALYVTDVQRLLSSPVLQEEMFGPASIVIRAKNFDEVLQLAEQLE
GQLTVTLQIDPADYADAQRLIPVLERKAGRILANGFPTGVEVCHAMVHGGPFPSTSNAMF
TSVGASAIDRFLRPVCYQDLPDVLLPAAVQQANPQGLARVINGDLEAR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattactggcgaaatgcttatcggcgcgagttcggtgcgcggtacagaaggacag
cagcaagcgttcgatccccgcatggatcaattcatcgcaacgcccacgttcggtatggga
gggcaggccgaagtggaccgggctgcccagttggcggcgcaggcatttgatccctaccgt
cagctgtcgcttgccaagcgtgcagaatttctggagctgattgccgacaacatcatggct
ttgggcgatgccctgatcgagcgcgccatggccgaaagcggcttgccgctggtgcgcctg
caaggcgagcgtgggcgcacggttggacagttgcggctgtttgccaaggtggtgcgcgat
ggccgttttatgagccccgccatcgaccacgcacagcccgagcgcacgccgctgccacgt
gccgacctgcgcctggccaagatggcactgggcccggtggcggtgttcggtgcgagcaat
tttccgctggcgttctcggtggcagggggcgatacggcgtcggccttggctgcaggtgcc
cctgtggtcgtcaaggcccacagtgcccatctaggcacttccgaaatggtgggtcgagcg
attcagaaagcggtcagagatttggggttgcccgaaggggtgttttccctgctgatggga
gccgggcgcaagctgggtgaagcattggtagcacatcctgccatcaaggccgttggcttt
accggatcgcgccagggagggcttgcgttgatgcgcatcgccaacgcacgcccggaaccc
attcccgtctacgcggagatgagcagcatcaacccggtgtttctgatgccggccgccctg
gccgcgcgtgcagagtcgatagggcgcggttttgccgattcgctgacgatgggggcgggg
cagttctgcaccaatcctgggatggtggtggtcattggtgaccgcaatgtgcagcgcttc
atcgatgccgcaagccaggcgcttgccaccaagccggcccagaccatgctgacgccgggc
attcaccaggcctttgatgccggcgttgccaaggttggtggtgcggaaggtgtggagaaa
gttgcacaggggcagcctgcggatggactgcacaatgctgcgcaggccgcgctgtatgtg
acggatgtgcagcgcctgttgtcatcgcctgtgctgcaggaggagatgtttggcccggcc
tctattgtcattcgggccaaaaacttcgatgaggttctccaactggctgagcaactggag
ggccagctgacagtgacgctgcagatcgatcccgcagactatgccgacgcgcagcgtctc
atccccgtgctggagcgcaaggcgggacgcatcttggccaatggttttccgaccggagtc
gaggtatgccacgccatggtgcatggaggtcctttcccatccacgtccaacgctatgttc
acttctgtgggcgccagcgccattgaccgctttctacgcccggtgtgttatcaggatttg
ccggatgtgctgctcccagcggctgtacagcaagcgaacccacagggacttgcccgagtg
atcaatggcgatctagaggcacgttga

DBGET integrated database retrieval system