KEGG   Comamonas testosteroni CNB-2: CtCNB1_4775Help
Entry
CtCNB1_4775       CDS       T01109                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00020  Citrate cycle (TCA cycle)
ctt00640  Propanoate metabolism
ctt00660  C5-Branched dibasic acid metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
Module
ctt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_4775
   00640 Propanoate metabolism
    CtCNB1_4775
   00660 C5-Branched dibasic acid metabolism
    CtCNB1_4775
Enzymes [BR:ctt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CtCNB1_4775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ACY35521
UniProt: D0IYC4
Position
complement(5339208..5340368)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRQFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEDVQKLSEQILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITEAQSRKVAAAIGLEGKSVDQAVDL
FAKIYKCYMDTDASLVEINPLNCDSKGDLMALDAKFNFDPNALFRHPEIVAFRDLDEEDA
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNPEVKGILVNIFGGIMKCDTIATGVVTACKAVNLSVPLVVRMKGTNEELGKQI
LKDSGLPIIAADTMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaataccaaggcaaggaaatcttgcgccaatttggtgtgcccgttccc
cgtggcattcctgcgtttaccgtgcaagaggctgttgaagcagcccagaagctgggtgga
cccgtgtgggtggtgaaggcccagatccacgctggcggccgcggcaagggcggcggcgtg
aaggttgccaagtccatcgaggacgtgcaaaagctgtccgagcagatcctgggcatgcag
ctggtgactcaccagaccggccccgaaggccagaaggtccgtcgcctgtacatcgaagac
ggcgccgacatcaagaacgagctgtatgtgtcgctggtgaccgaccgcgccacgcagaag
gttgccctgatcgcttccagcgaaggcggcatggacatcgaggaagtggctcactccact
cccgaaaagatcatcaccgagatgatcgaccccctgaccggcatcaccgaagcgcaatcg
cgcaaggtggcagctgccatcggtctggaaggcaagtccgtggatcaggccgtggatctg
ttcgccaagatctacaagtgctacatggacaccgacgcgtcgctggtggaaatcaacccc
ctgaactgcgactccaagggcgacctgatggccctggacgccaagttcaactttgacccc
aacgctctgttccgtcaccccgaaatcgtggctttccgcgatctggacgaagaagacgct
gccgaaatcgaagcctccaagttcgatctggcctacatctccctggacggcaacatcggc
tgtctggtgaacggcgccggtctggccatggccaccatggacaccatcaagctgttcggc
ggcgaaccagccaacttcctggacgtgggcggcggcgctacggccgagaaggtgaccgaa
gccttcaagatcatgctcaagaaccccgaagtcaagggcattctggtcaatatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtggtcactgcctgcaaggccgtgaac
ctgtccgtgcctctggtcgtgcgcatgaagggcaccaacgaagaactgggcaagcaaatc
ctcaaggattccggcctgcccatcatcgctgccgacaccatggctgaagcagcgaccaag
atcgttgctgccgttaagtaa

DBGET integrated database retrieval system