KEGG   Cronobacter turicensis: CTU_00650
Entry
CTU_00650         CDS       T00999                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ctu  Cronobacter turicensis
Pathway
ctu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CTU_00650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_00650
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_00650
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CBA26721
UniProt: C9Y412
Position
62476..62919
AA seq 147 aa
MSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADFFSLQNNAQTVL
GANLLNSDEFFLMPGQLDKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPTDSSI
YKFWKWSSDELEAKVFLDVNGIRVINE
NT seq 444 nt   +upstreamnt  +downstreamnt
ctgagcggctgcttatcgtcttcacgcagcgttccttcccagtacagcctgcattttcag
gctcacccgcaaattaataattccgccccgctgaaagtccgggtgctgcttttgaaatcc
gatgccgactttatgtctgccgatttcttttcgctgcaaaacaatgctcagaccgtgctg
ggagcgaacctgctcaacagcgacgagttcttcctgatgccaggccagctggataaaacc
ctcagcggccagagctcgcttgacgcgcgctacatcggcgtgatggcggaatatcaggcg
ctggacggcaagaagtggcgaatctcgctcccgctccccgcacccacggactccagtatt
tacaaattctggaaatggtcatccgacgaacttgaggcgaaagtgtttcttgacgtcaac
gggatccgcgtcatcaacgaataa

DBGET integrated database retrieval system