KEGG   Cronobacter turicensis: CTU_00760
Entry
CTU_00760         CDS       T00999                                 

Gene name
hcp1
Definition
(GenBank) Protein hcp1
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ctu  Cronobacter turicensis
Pathway
ctu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CTU_00760 (hcp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_00760 (hcp1)
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_00760 (hcp1)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBA26742
UniProt: C9Y423
Position
74150..74632
AA seq 160 aa
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNA
LIDKSTTAILKHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTV
GVTYAFQAAKVKQQYWEQTATGGKGAETSAGWNIKENKEA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatgttcctgaaagtagacggtgtaaccggcgaatctaaagattctaac
cacaccggctggaccgacatcacctctttttcctggggcgcatcccagccgggtaatatg
agcgtgggcggcggcggcggtgccggtaaagtgaatttcaacgatctgcacgttaacgcg
ctgatcgacaaatccaccaccgctatcctgaagcactgctccagcggtaagcacctgacc
aaagttgagctgtctgtctgcaaagcaggcggccagcaggtggaatacacccgtatcact
ctggaagatgtgctggtgacttccgttcagtacaccggtgctgacaacggcgacaccgtt
ggcgttacttatgcattccaggctgcgaaagtgaaacagcagtactgggagcagactgcg
accggcggtaaaggcgcagaaaccagcgctggctggaacatcaaagaaaacaaagaagcg
taa

DBGET integrated database retrieval system