KEGG   Cronobacter turicensis: CTU_00860
Entry
CTU_00860         CDS       T00999                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_00860
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_00860
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CBA26762
UniProt: C9Y433
Position
82716..83759
AA seq 347 aa
MSETLPQNAPVKSASRLPENYWQQMMAAPWRYDLFQMLRRLDAQGGERYRLGRAPLPRFE
PLRIGQQPSMAFAPSTLAAVKPRDNTPLHDVSILSFGLFGPNGPLPMHLTEYARERLYHH
QDDSLSAFADLFHHRLTLLFYRAWADAQPTASLDRADGPRIEKYLAALIGMGQPGQMEKG
SLSHHARYSLVGHLTRNGRDAEGLEKILRHYFRVPVTIVQNIPQWMPLTEREKARLGAGR
RIPRLGNAAFLGVAVRDVQHKFRIELGPLDEETYQRFLPGEPWVEELRDWVRQYMGIEYE
WEVRVILRADAVKGVTPGGTGRLGYSAWLGKQPTPQPRGDLVFRAES
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagtgagacgctgccacagaacgcgccggtaaaaagcgcgtcccggctgccggaaaac
tactggcaacagatgatggccgcgccgtggcgctacgatctgttccagatgctgcgccgt
ctcgacgcgcagggcggcgaacgctaccgtttaggccgcgcgccgctgccgcgctttgag
ccgctgcgcatcggccagcagccgtcgatggcctttgcgccgtcgacgcttgccgcggtg
aaaccgcgcgacaacacgccgctgcacgatgtgtcgattttaagcttcggcctgtttggc
ccgaacggcccgctgccgatgcacctgaccgaatatgcgcgcgagcgtctgtatcatcat
caggatgacagcctgagcgcgttcgcggatctgtttcatcaccgcctgacgctgctgttc
taccgcgcctgggccgatgcccagccgaccgcgtcgctcgaccgcgccgacgggccgcgc
attgaaaaatacctcgccgcccttatcggcatgggccagccggggcagatggaaaagggc
agcctgagccaccacgcgcgctattcgctggtcggccatctgacccgcaacgggcgcgac
gccgaagggctcgaaaaaatcctgcgccactatttccgcgtgccggtgacgattgtgcag
aacatcccgcagtggatgccgttaaccgagcgtgagaaagcgcgtctcggcgcgggccgc
cggataccgcgcttgggcaacgccgcgtttctcggcgtggcggtgcgcgacgtacagcat
aaatttcgcattgaactcgggccgctggatgaagagacctatcagcgttttctgcccggc
gagccgtgggttgaggagctgcgcgactgggtgcgtcagtatatgggcattgagtatgag
tgggaggtgcgcgtcattctgcgcgccgatgcggtgaaaggcgtcacgcctggcggcacg
ggccgtctgggctacagcgcctggcttgggaagcagcccaccccgcaaccgcgcggcgat
ctggtttttcgcgcggaaagttaa

DBGET integrated database retrieval system