KEGG   Cronobacter turicensis: CTU_05970Help
Entry
CTU_05970         CDS       T00999                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00240  Pyrimidine metabolism
ctu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CTU_05970 (deoA)
Enzymes [BR:ctu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CTU_05970 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CBA27778
UniProt: C9XUZ7
Position
640140..641462
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKNVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSEALAQAIVGVANGAGVRTTALLT
DMNEVLASSAGNAVEVREAVRFLTGDYRNPRLLEVTMALCVEMLLSGGLAKDESEARAKL
QQVLDNGQAAEIFGRMVAAQNGPADFVDNYDRYLPAATLSKAVYADRSGFVTQMDTRALG
MAVVAMGGGRRQASDSIDYSVGLTDMARLGEQVDGERPLAVIHAKSEASWQEAAAAVKAA
IHVDDTAAKASPVVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctcgctcaagaaataattcgtaaaaagcgcgacggccatgcgctcagcgacgaa
gagatccgcttctttattaacggcattcgcgataacaccgtgtccgaaggccagatcgcc
gcgctggcgatgacgattttctttcacgacatgacaatgccggagcgagtttcgctgacg
atggcgatgcgcgattccggcaccgtgctggactggaaaagcctgaaccttaacggcccg
gtcgtggataaacattccaccggcggcgtgggcgacgtgacctcgctgatgctcggcccg
atggtcgcggcttgcggcgggtacatcccgatgatttccgggcgcggactgggccacacc
ggcggcaccctcgataaactggaagcgatcccggggtttgatattttcccggacgacaat
cgctttcgcgacattattaaaaatgtgggcgtggcgattatcggccagaccaattcgctg
gcgcctgcggataaacggttttacgccacgcgcgacatcactgcgaccgtcgattcaatt
ccgctgatcaccgcctcgatcctcgcgaaaaaactcgcggaagggctggatgcgctggta
atggacgtgaaagtgggcagcggggcgtttatgccgacctatgcgctgtctgaagcgctg
gcgcaggcgatcgtcggggtggcgaacggcgcgggcgtgcgcacaaccgcgctgctgacc
gatatgaacgaagtcctggcctccagcgccggtaacgcggtggaagtgcgtgaagcggtg
cggttcctgaccggcgattaccgcaacccgcgtcttcttgaagtgaccatggcgctgtgc
gtcgagatgctgctctccggcgggcttgcgaaagacgagagtgaggcgcgcgcgaaactg
caacaggtgctggataacggccaggcggcggaaattttcgggcgtatggtggcggcgcaa
aacggcccggcggattttgtcgacaactacgatcgttatttgccggcggccacgctcagc
aaagcggtctatgccgaccgttccggctttgtcactcagatggatacccgcgcgctgggc
atggcggtcgtggccatgggcggcggtcgtcgtcaggcgtctgacagcattgattacagc
gtcggcctgaccgatatggcgcgcctgggcgagcaggttgatggcgagcgtccgctggcc
gttatccacgcgaagagcgaagcaagctggcaggaagcggcggcagccgttaaagcggcc
attcatgttgacgatacggcggcgaaagcgtcaccggttgtctatcgcagaatcagcgaa
taa

DBGET integrated database retrieval system