KEGG   Cronobacter turicensis: CTU_07500Help
Entry
CTU_07500         CDS       T00999                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase c.
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00010  Glycolysis / Gluconeogenesis
ctu00020  Citrate cycle (TCA cycle)
ctu00620  Pyruvate metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Module
ctu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_07500 (aceF)
   00020 Citrate cycle (TCA cycle)
    CTU_07500 (aceF)
   00620 Pyruvate metabolism
    CTU_07500 (aceF)
Enzymes [BR:ctu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTU_07500 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: CBA28084
UniProt: C9XVS4
Position
808589..810490
Genome map
AA seq 633 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKVETGKLIMIFDSADGAADAAPAKAEEKKEAAPAQSAAPAAAAAKDVNVPDIGGDEV
EVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFE
VAGAAPAAEAKPQVTEQAASAPAAAAGAKDVNVPDIGGDEVEVTEVLVKVGDKVTAEQSL
ITVEGDKASMEVPAPFAGTVKELKVNVGDKVSTGSLIMVFEVEGAAPAAAPAAKQEAAAP
APAAKADKPAAAPAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILR
EDVQAYVKDAVKRAESAPAAASGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLS
RNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRF
NSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTVISKKARDGK
LTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPI
SLSFDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaatgtaccggacatcggggcggacgaagttgaagtcaccgagatc
ctggtcaaagtgggcgacaaggttgaagctgaacagtcgctgatcaccgtagaaggcgat
aaagcctctatggaagtcccgtctccgcaggcgggcgtggtcaaagagatcaaagtgtcc
gtgggcgacaaagtcgaaaccggcaaactgatcatgattttcgattccgccgacggtgca
gcagacgctgcacctgccaaggcagaagagaagaaagaagcggcaccggcgcagtctgct
gccccggctgcagcggcagcaaaagacgttaacgtaccggacatcggcggcgacgaagtt
gaagtcaccgagatcctggtgaaagtcggcgataaagttgaagctgagcagtctcttatc
accgtagaaggcgacaaagcctctatggaagttccggcgccgttcgcgggtaccgtgaaa
gagatcaaaatcaataccggcgacaaagtgtctaccggttccctgatcatggtcttcgaa
gtggcgggcgcagcgccagcggctgaagccaaaccgcaggtcaccgagcaggcggcgtcc
gctccggcggcagcggcaggcgcgaaagacgtcaacgtgccggatatcggcggcgatgaa
gtcgaagtgaccgaagtgctggtgaaagtgggcgacaaagtcaccgctgaacagtctctg
ataaccgtagaaggcgacaaagcctctatggaagtcccggcgccgttcgcgggcaccgtg
aaagagctgaaagtcaacgtgggcgataaagtctccaccggctctctgatcatggtcttc
gaagtggaaggcgcagcgcctgcggcggctccggctgcgaaacaggaagcggcggctccg
gctccggcggcgaaagctgacaaaccggctgcggctccggcgaaagccgaaggcaaatct
gaatttgctgagaacgacgcttacgtccacgcgacgccgctgatccgccgcctggcgcgc
gaattcggcgtgaacctcgcgaaagtgaaaggcaccggtcgtaaaggccgtatcctgcgc
gaagacgttcaggcttatgtgaaagacgcggtgaaacgcgctgagtcggcacctgccgcc
gcatccggtggtggtctgccaggcatgctgccgtggccgaaagtggacttcagcaagttt
ggcgaagtggaagaagttgagctgggccgcatccagaaaatctctggcgcgaacctgagc
cgtaactgggtgatgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctg
gaagcgttccgtaagcagcagaacgccgaagctgagaagcgcaagctggacgtgaaattc
accccggttgtcttcatcatgaaagccgttgcggctgcccttgagcagatgccacgcttc
aacagctcgctgtctgaagacgggcagcgcctgacgctgaagaaatacatcaacatcggc
gttgccgttgatacgccgaatggtctggtggttccggtcttcaaagacgtgaacaagaag
agcattaccgagctgtctcgcgagctgaccgttatctccaaaaaagcgcgcgatggcaaa
ctgaccgctggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggc
accacccacttcgcgccgatcgtgaacgcgccggaagtggctatcctgggcgtctccaag
tctgcgatggagccggtgtggaatggtaaagagttcgtgccgcgcctgatgctgccgatc
tccctgtccttcgaccaccgcgtgatcgacggtgctgatggtgcgcgtttcatcaccatc
atcaacaacaccctgtcggacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system