KEGG   Cronobacter turicensis: CTU_11100Help
Entry
CTU_11100         CDS       T00999                                 

Gene name
ppiB
Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase B
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ctu03110]
    CTU_11100 (ppiB)
Enzymes [BR:ctu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CTU_11100 (ppiB)
Chaperones and folding catalysts [BR:ctu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    CTU_11100 (ppiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: CBA28823
UniProt: C9XXX6
Position
complement(1197702..1198196)
Genome map
AA seq 164 aa AA seqDB search
MVTFHTNHGDIVIKTFDDKAPETVKNFLEYCREGFYDNTIFHRVINGFMIQGGGFEPGMK
QKSTKDPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVADNDFLNFSGESLQGWGY
CVFAEVVEGMDVVDKIKGVSTGRSGMHQDVPKEDVIIERVTVSE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggttacttttcacaccaatcacggcgacatcgtaatcaagacctttgatgacaaagcg
ccggaaacggtaaaaaactttctggaatattgccgcgaaggtttctacgacaacaccatt
ttccatcgtgtaatcaatggctttatgattcagggcggcggctttgagccgggcatgaaa
cagaaaagcaccaaagatcctatcaaaaacgaagccaacaacggcctgaagaacacccgc
ggcacgctggcaatggcgcgcacgcaggcgccgcactccgcgactgcccagttcttcatc
aacgttgcagataacgacttcctgaacttcagcggcgaaagcctgcagggttggggctac
tgcgtattcgcagaagtggtagaaggcatggacgtggttgataaaatcaaaggcgtatcc
accggccgcagcggcatgcatcaggatgtgccgaaagaagacgtgattatcgagcgcgta
accgtcagcgagtaa

DBGET integrated database retrieval system