KEGG   Cronobacter turicensis: CTU_12160
Entry
CTU_12160         CDS       T00999                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_12160
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_12160
SSDB
Motif
Pfam: VipB VipB_2 DUF1877
Other DBs
NCBI-ProteinID: CBA29039
UniProt: C9XYL1
Position
1275122..1276624
AA seq 500 aa
MSMSQTQQSHNAAASAVEIDDFNALLAREFKPRSDQTRSAVEGAVKTLAEQALVNAVTLS
DDAYKCIASIIAEIDRKLSEQINLILHHDEFQTLESAWRGLHYLVTHTETDEKLKLRFLD
ISKTDLRRTMKRYKGVAWDQSPLFKKVYEEEYGQLGGEPYGCLVADYYFDHSAPDVDLLA
SLAKVAASAHVPFITGASPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRLAEDSRY
IGLAMPRFLARLPYGIRTNPVDEFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDADATANANLSARLPYMFACSRFAHYLKCIVRDKIGTFKERD
DMQRWLNDWIMNYVDADPTNSSLETKSRRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKHVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtctatgagtcaaacacagcaatcccacaacgccgctgcgtctgccgttgaaatcgat
gattttaatgcgctgcttgcaagagaatttaaaccacgttcggatcagactcgctctgcc
gttgaaggggccgtcaaaacgctggcggagcaggcgctggttaatgccgtcacgctatct
gatgatgcctacaagtgcattgcatcaatcattgcggaaattgacagaaaactctctgag
caaatcaaccttattttacatcacgacgagtttcagacgctggagagcgcctggcgtggc
ctgcattatctggtcacccatactgaaacagacgaaaagttaaagttacgctttctggat
atttccaaaaccgacctgcgccgtacgatgaaacgctataaaggcgtcgcatgggatcag
agcccgctatttaaaaaagtctatgaagaagagtacgggcagttgggcggcgagccctac
ggctgtctggttgccgattattatttcgatcacagcgcgcctgatgtcgatctcctggcc
tcgctcgctaaagtggcggcctctgcgcatgttccctttattaccggcgcttcgccatcc
gtgctgcagatggaatcctggcaggagctttccaaccctcgcgatctgacaaaaatcttc
acgcagaatcttgagtatgcggcctggaattcactgcgcctggcggaagattctcgctat
atcggtcttgccatgccgcgtttcctggcccgtttgccctacggcattcgcaccaatccg
gttgacgagtttcattttgaagaaacgactgacggcgcagaccattcaaaatatgtctgg
tcaaatgccgcctatgcgatggctgttaatatcaaccgttcctttaaagaatatggctgg
tgtacgctcattcgcggcgttgaaagcggcggtgtcgtggaagggttgccgtgccatacc
ttcccgacagacgatggcggcattgacatgaagtgcccgacggaaattgctatatctgat
cgtcgcgaagctgagctcgccaaaaatggttttattccgctcgtgcatcgtaaaaatacg
gattatgccgcttttattggcgcacagtctttgcaaaaacctgctgaatattatgatgca
gacgctactgccaatgcgaatttatcggcgcgtttaccctatatgttcgcctgctcgcgt
tttgcgcattatttgaaatgtatcgttcgcgataaaatcggtacttttaaagagcgcgac
gatatgcagcgctggctgaatgactggatcatgaattatgtcgacgccgatcccactaac
tcatcgttagaaacgaaatcgcgccgtccgctcgccgccgcggaagttattgtggaggat
gtggaaggaaatccgggttattaccaggcgaaattctttttacgtcctcatttccagctt
gaaggcttaacggtgtcattacgcatggtcgcgaaactgccgtcgttgaaacatgttgcc
tga

DBGET integrated database retrieval system