KEGG   Cronobacter turicensis: CTU_12270
Entry
CTU_12270         CDS       T00999                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_12270
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_12270
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CBA29062
UniProt: C9XYM2
Position
1289589..1290071
AA seq 160 aa
MERKKQFAPTLLDRLLDEEPKARHEAHDASFISARHYRQRVLRDIDILLNNTNIEALIDP
ERHPAVIDSVINHGLAPLSGKYATPHSGSAVEQAIRNALLRFEPRIIASSLVVRPKRQPA
VGTTLLFEIAALLYWQPEPIGLTVSGSYDTETEKTTLTAL
NT seq 483 nt   +upstreamnt  +downstreamnt
atggagagaaaaaagcaattcgcgccgacgctgctggaccggctgctggacgaggagccg
aaagcccgccacgaggcgcatgacgcgagctttatcagcgccaggcattaccgtcagcgg
gtactgcgcgatatcgacatcttgcttaacaataccaatattgaggcgctgatcgatcct
gaacgtcacccggctgtcatcgactcggtgataaaccacggcctggcgccattatccggg
aaatacgccacgccgcacagcgggtctgcggtggagcaggccattcgcaacgccttgctg
cgctttgagccgcgcatcatcgcgtcgtcgctggtggtgcgcccgaaacgtcagccagcc
gttggcaccacgttgctctttgaaatagccgcgttgctttactggcagcctgagccgatc
gggctgacggtgagtggtagttatgataccgaaacggaaaaaacaacgctgacggcgtta
taa

DBGET integrated database retrieval system