KEGG   Cronobacter turicensis: CTU_13330Help
Entry
CTU_13330         CDS       T00999                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydro.
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00020  Citrate cycle (TCA cycle)
ctu00310  Lysine degradation
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Module
ctu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTU_13330 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CTU_13330 (sucB)
Enzymes [BR:ctu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTU_13330 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBA29273
UniProt: C9XZA6
Position
1409331..1410551
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWRKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGSTVTSRQILGRLREGNSAGKESSAKPEAKESTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDVEKHLAKANGSESAKAPEQAAAPQPQLGARSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFYV
KAVVEALKRFPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDVLGMADIEKKI
KELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVD
GKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatccgttgctgacgcaaccgtc
gccacctggcgcaaaaagccgggcgacgcggtgaaacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcgtcggctgacggcgtgctggatgcggta
ctggaagacgaaggcagcaccgtaacgtctcgccagatcctgggccgtctgcgcgaaggc
aacagcgcgggcaaagagagcagcgccaaaccggaagcgaaagaatcgaccccggcgcag
cgccagcaggcgtctctggaagaacaaaataacgacgcgctgagcccggcaatccgccgt
ctgctcgccgaacacaacctggatgcggccgccatcaaaggcaccggcgtcggcggtcgt
ctgacccgtgaagatgtcgaaaaacatctggcgaaagcgaacggcagcgaatctgccaaa
gccccggaacaagccgccgcgccgcagccgcaactcggcgctcgcagcgaaaaacgcgtg
ccgatgacccgcctgcgcaaacgcgtggccgagcgtctgctggaagcgaaaaactccacc
gcgatgctgaccacgttcaacgaagtgaacatgaagccgatcatggatctgcgtaagcag
tacggcgacgccttcgaaaaacgtcacggcatccgtctgggctttatgtccttctacgtg
aaagcggtcgttgaagcgctcaaacgcttcccggaagtgaacgcgtccatcgatggcgat
gacgtggtttatcacaactatttcgacgtcagcatggcggtctccacgccgcgcggcctg
gtgaccccggttctgcgcgatgtcgacgtgcttggcatggcggatatcgagaagaaaatt
aaagagctggccgtgaaaggccgtgacggcaaactgaccgttgaagacctgaccggcggt
aacttcaccattaccaacggcggcgttttcggctcgctgatgtccacgcctatcatcaac
ccgccgcagagcgcgatccttggcatgcacgccattaaagatcgcccgatggcggtggac
ggcaaggttgagatcctgccgatgatgtacctggcgctctcttacgatcaccgtctgatc
gatggccgtgaatcggtaggtttcctggtgaccattaaagagttgctggaagatccgact
cgtctgctgctggacgtgtag

DBGET integrated database retrieval system