KEGG   Cronobacter turicensis: CTU_13340Help
Entry
CTU_13340         CDS       T00999                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00020  Citrate cycle (TCA cycle)
ctu00640  Propanoate metabolism
ctu00660  C5-Branched dibasic acid metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Module
ctu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTU_13340 (sucC)
   00640 Propanoate metabolism
    CTU_13340 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CTU_13340 (sucC)
Enzymes [BR:ctu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CTU_13340 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CBA29275
UniProt: C9XZA7
Position
1410662..1411828
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARSGLPTPVGYACSTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRGSRR
VVFMASTEGGVEIEKVAEETPHLIHKVAIDPLTGPMPYQGRELAFKLGLEGKLVQQFTKV
FMGLATIFLERDLALIEINPLVITSQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaggcgaaacagctgtttgccagatcaggcctgccgacgccg
gtaggttatgcctgctcgactccgcgtgaagcagaagaagccgcctctaaaatcggctcc
ggcccgtgggtggtgaaatgccaggtgcacgcaggcggccgcggtaaagcgggcggtgta
aaagtcgttaagagcaaagaagagattcgcgcctttgccgagcactggctgggcaaacgc
ctggtgacctatcaaacggacgcgaacggccagccggttaaccagattctggtagaagcc
gcgaccgatatcgccaaagaactctacctcggcgcggtcgttgaccgcggctcccgtcgc
gtggtgtttatggcctccaccgaaggcggcgtggaaatcgaaaaagtggcggaagaaacc
ccgcacctgatccacaaagtcgccatcgatccgctaaccggcccaatgccgtatcaggga
cgcgagctggcctttaaactgggcctcgaagggaaactggttcagcagttcaccaaagtc
tttatggggctggccactattttcctggagcgcgacctggcgcttatcgaaatcaacccg
ctggtgatcacctctcagggcgacctgatctgcctcgacggtaaactgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgcgaccagtctcaggaagacccg
cgcgaagcgcaagcggcgcagtgggaactgaactacgtggcgctggacggcaacatcggt
tgcatggtgaacggcgcgggcctcgcgatgggcacgatggatatcgtgaagctgcacggc
ggcgaaccggcgaacttcctggacgtgggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgacaaagtgaaagccgtactggttaacatcttcggc
ggcatcgtgcgctgcgacctgattgccgacggcatcatcggcgcggtggcggaagtcggc
gtgaacgtcccggttgtcgtgcgtctggaaggcaacaacgccgagctgggcgcgaagaaa
ctggccgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgctgctgtggaggggaaataa

DBGET integrated database retrieval system