KEGG   Cronobacter turicensis: CTU_19330Help
Entry
CTU_19330         CDS       T00999                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ctu  Cronobacter turicensis
Pathway
ctu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CTU_19330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctu02044]
    CTU_19330
Secretion system [BR:ctu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CTU_19330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CBA30473
UniProt: C9Y2Y2
Position
2025337..2025828
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHTLYIPTDNNTGKLTGTRIHTPFL
FTKEIDASSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPLMHD
IKDPSKEKHNHLERIELRYEKITWTYKDGNIIHSDSWNERTTA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaggacgatggcggcgcggacatcaagggttcc
gttgacgtgaaggatcgcgaaggcagcatcgaggtggtggcgcaggagcacaccctgtac
atcccgaccgacaacaacaccggcaagctgacgggtacccgtattcacacgccgttcctg
ttcactaaggagatcgacgcgtccagcccgtacctctacaaggcggtgaccaccggccag
accctgaaatcggcagagttcaaatggtaccgcattaacgacgcgggccaggaagtggag
tacttcaacacgaaactggagaacgtgaagctggtgaaagtggcgccactgatgcacgac
atcaaggacccgtccaaggagaagcacaaccatcttgagcgcattgaactgcgctacgaa
aaaatcacctggacctacaaggacggcaacatcattcattccgactcctggaacgaacgt
accaccgcctga

DBGET integrated database retrieval system