KEGG   Cronobacter turicensis: CTU_22760Help
Entry
CTU_22760         CDS       T00999                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00010  Glycolysis / Gluconeogenesis
ctu00071  Fatty acid degradation
ctu00350  Tyrosine metabolism
ctu00625  Chloroalkane and chloroalkene degradation
ctu00626  Naphthalene degradation
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_22760 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CTU_22760 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTU_22760 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CTU_22760 (adhA)
   00626 Naphthalene degradation
    CTU_22760 (adhA)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CTU_22760 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBA31158
UniProt: C9Y548
Position
complement(2387686..2388690)
Genome map
AA seq 334 aa AA seqDB search
MVKAFGQPLEIQEVLVPEVTPGKVLVKIAATGVCHTDLHAAEGDWPVKPNPPFIPGHEGV
GHVVAVGQGVTHIKEGDRVGVPWLYSACGHCEHCLSGWETLCHGQQNSGYSVNGTFAEYC
LADANYVGILPDNVEFTSIAPILCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHLAIQYA
NAMGLNVAAVDIDKDKLEFAKRLGAQVVANALEVDPGSYFHDTFGGAHGVLVTAVSPKAF
AQATTMMRRGGTMVLNGLPPGKFDLSIFDMVLDGTTVRGSIVGTRKDLQEALDFAGHNKV
AAEIAVEPLENINDIFARMRNGKITGRIVVDMSL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaagccttcgggcagccgctggagatccaggaagtgctggtgccggaagtgacg
ccgggtaaagtgctggtgaaaatcgccgcgaccggcgtctgccataccgatttacacgcg
gcggaaggcgactggccggtgaaaccgaacccgccgtttattccggggcacgaaggcgta
ggccacgtcgtggcggtcggtcagggggtgacgcacattaaagagggcgatcgcgtcggc
gtgccgtggctctattccgcctgcggccattgcgaacactgcttaagcggctgggaaacg
ctctgtcacggccagcaaaactccgggtattcggtgaacggcacctttgcggagtattgc
ctggcggatgccaattacgtcggcatcttgccggataatgttgaattcaccagcattgcg
ccaatcctctgcgcgggcgtcacggtctataaagggctgaaaatgaccgacaccaaaccg
ggcgactgggtggtgatttccggtattggcgggttagggcatctggctattcagtacgcc
aacgccatggggctgaacgtggcggcggtggatatcgacaaggataagctggagttcgcg
aaacgcctcggcgcgcaggtcgtcgccaacgcgctggaagtcgatccgggcagctatttc
catgacaccttcggcggcgcgcacggcgtgctggtgacggcggtctcgccaaaagcgttc
gcgcaggccacaacaatgatgcgccgtggcggcaccatggtgttaaacggcctgccgccg
ggcaaattcgatctctctatcttcgatatggtgctggacggcacgacggtgcgcggctcg
attgtgggcacgcgtaaagacttgcaggaggcgctcgatttcgccgggcataacaaagtg
gcggcggaaattgcggtcgagccgctggagaatatcaacgatattttcgctcgtatgcgt
aacgggaaaatcaccggccgcatcgtggttgatatgtcgctgtaa

DBGET integrated database retrieval system