KEGG   Cronobacter turicensis: CTU_27070Help
Entry
CTU_27070         CDS       T00999                                 

Gene name
gyrI
Definition
(GenBank) DNA gyrase inhibitory protein
  KO
K07470  DNA gyrase inhibitor
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    CTU_27070 (gyrI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GyrI-like Cass2
Motif
Other DBs
NCBI-ProteinID: CBA32017
UniProt: C9XVF1
Position
complement(2815668..2816141)
Genome map
AA seq 157 aa AA seqDB search
MDYTIEHVLTRKIAGFHLVGPWEKTVPQGFEQLTLWVDNFHIQPQAWLAVYYDNPQQVAP
EKLRADTVVEVPADFTLPENSVGVILTDLPGGQYAVARARVENHDFGTPWLAFFTRLHQD
VRYQMAARPCFEIYLNDGKRDGYWEIDMYIPVQTSGE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggattacaccatcgagcatgtcttaacgcgtaaaattgccggttttcatctggtcggc
ccgtgggagaaaacagtgccgcaggggtttgaacagctcacgctgtgggtggataacttc
catatccagccgcaggcgtggctggcggtttattacgataatccgcagcaggtcgccccg
gagaagcttcgcgccgatacggtggttgaggtgccggcggatttcaccctgccggagaac
agcgtcggcgttatcctgacggacctgccgggcggtcagtatgcggtggcgcgcgcgcgc
gttgagaaccacgatttcggcacgccgtggctcgcgttctttacccgtctgcatcaggac
gtgcgttaccagatggcggcgcgtccgtgttttgaaatctatctcaacgatggtaaacgg
gacggctactgggagatagacatgtatatcccggtgcaaacctcaggcgaataa

DBGET integrated database retrieval system