KEGG   Cronobacter turicensis: CTU_29960Help
Entry
CTU_29960         CDS       T00999                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00010  Glycolysis / Gluconeogenesis
ctu00052  Galactose metabolism
ctu00500  Starch and sucrose metabolism
ctu00520  Amino sugar and nucleotide sugar metabolism
ctu00521  Streptomycin biosynthesis
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Module
ctu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ctu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_29960 (glk)
   00052 Galactose metabolism
    CTU_29960 (glk)
   00500 Starch and sucrose metabolism
    CTU_29960 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CTU_29960 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTU_29960 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTU_29960 (glk)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CTU_29960 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CBA32601
UniProt: C9XXD4
Position
complement(3127131..3128096)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVDSGEILKAKTYSGLDYPSLEAVVRVYLKEHNATVTDGC
IAIACPITGDWVAMTNHVWAFSVAEMKKNLGFDHLEIINDFTAVSMAIPMLKTDHLIQFG
GGEAQPNKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEQLRAE
VGHVSAERVLSGPGLVNLYRAIVKADGRLPDNLRPKDITERALDDSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLDFFTSSGFRGGFEDKGRFKTYVQDIPVYLIV
HDQPGLLGAGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatatgctttggtgggagacgtaggcggcaccaacgcacgcttagcgctgtgc
gacgtagacagcggcgagatactcaaggcgaaaacttattccggccttgattatccgagc
cttgaagcggtggtgcgggtgtatctgaaagagcataacgccacggtaacggatggctgc
atcgccattgcgtgtccgattaccggcgactgggtggcgatgaccaaccacgtctgggcg
ttttctgtcgccgaaatgaaaaagaatctcggcttcgatcatctggaaattattaacgat
ttcaccgccgtttccatggcgatcccgatgctcaaaaccgaccatctgatccagttcggc
ggcggcgaagcgcagcccaataaaccgatcgccgtttatggcgcgggcaccggacttggc
gtcgcgcaccttgtgcatgtcgataagcgctgggtgagcctgccgggcgagggcggccac
gtcgatttcgcgccgaacagcgaagaagaggcgattattcttgagcagctgcgcgccgaa
gtcggccacgtttccgccgagcgcgtgttgtcagggccaggtctggtgaacctctaccgc
gcgattgtcaaagccgatggtcgtctgccggacaacctgcgtccaaaagacatcaccgaa
cgcgcgctggatgacagctgcaccgactgccgtcgcgcgctgtccctcttctgcgtcatc
atgggccgtttcggcggcaacctggcgctgacgctcggcacctttggcggcgtctacatc
gcaggcggcatcgtgccgcgcttcctggatttcttcacctccagcggttttcgcggcggg
tttgaagataaaggccgctttaaaacctacgtacaggatattccggtctatctgattgtt
cacgaccagccagggctgctcggcgcgggcgcgcatctgcgccagacgctggggcagatc
ctctga

DBGET integrated database retrieval system