KEGG   Cronobacter turicensis: CTU_30660Help
Entry
CTU_30660         CDS       T00999                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00300  Lysine biosynthesis
ctu01100  Metabolic pathways
ctu01120  Microbial metabolism in diverse environments
ctu01230  Biosynthesis of amino acids
Module
ctu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CTU_30660 (dapE)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CTU_30660 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: CBA32738
UniProt: C9XXK4
Position
3198891..3200018
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLRAVGFTVEPMNIGDTQNFWAWRGTGET
LAFAGHTDVVPAGDVERWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAANGTVKVVEALMARGERLDYCLVGEPSSSEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDRGNEFFPPTSMQIANIQAGT
GSNNVIPGDLHVQFNFRFSTQLTDEMIKQRVVALLEQHQLRYTLDWWLSGQPFLTARGKL
VDAVVNAVHHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVKASDLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcccggttattgagctgacgcagcagcttattcgtcgcccttctcttagcccc
gatgatgcgggctgccaggcgctgctgatcgagcggctgcgtgccgtagggtttacggta
gagccgatgaatattggcgacacgcagaacttctgggcatggcgcggcaccggcgaaacg
ctggccttcgcggggcataccgatgtggtgcccgcaggcgatgttgagcgctggatcaat
ccgccgtttgaacccacgatccgcgacgggatgctttttggccggggtgcggcggacatg
aaaggctcgctggcggcgatggtcgtggcggcggagcgctttgtcgcgcagcatccgcac
catcgcgggcgcctggcgtttcttatcacctctgatgaagaagcgagtgccgccaacggt
accgttaaagtagtggaagcgctgatggcgcgcggagaacgtctcgattactgcctggtg
ggcgaaccgtccagcagtgaagtggtcggcgatgtggtgaaaaatggccgtcgcggctcg
ctcacctgcaacctgaccattcacggcgtgcagggccacgtggcgtatccgcatctggcg
gataacccggtgcaccgcgccgcgccgatgcttaatgaactggtcggtatcgagtgggat
cgcggcaatgaatttttcccgcccaccagcatgcagattgccaatattcaggcgggcacc
ggcagcaacaacgtcattccaggcgatctccacgtgcagtttaatttccgcttcagcacg
cagctgaccgacgagatgattaaacagcgcgtcgtggcgctgctggagcagcaccagctg
cgctatacgctggactggtggctctccggccagccattcttaaccgcgcgcggtaaactg
gtcgatgcggtcgtcaacgccgttcaccactataatgaaattaaaccgcagctgctgacc
acaggcggcacgtccgacgggcgctttatcgcccgcatgggcgcgcaggtagtggagctt
gggccggtcaacgcgacgattcacaagatcaatgaatgcgtcaaagcgtctgacctgcag
ctgctggctcgtatgtatcaacgcattatggagcaactcgtcgcctga

DBGET integrated database retrieval system