KEGG   Cronobacter turicensis: CTU_34080Help
Entry
CTU_34080         CDS       T00999                                 

Gene name
yqeF
Definition
(GenBank) Probable acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00071  Fatty acid degradation
ctu00280  Valine, leucine and isoleucine degradation
ctu00310  Lysine degradation
ctu00362  Benzoate degradation
ctu00380  Tryptophan metabolism
ctu00620  Pyruvate metabolism
ctu00630  Glyoxylate and dicarboxylate metabolism
ctu00640  Propanoate metabolism
ctu00650  Butanoate metabolism
ctu00900  Terpenoid backbone biosynthesis
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
ctu01212  Fatty acid metabolism
ctu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTU_34080 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    CTU_34080 (yqeF)
   00640 Propanoate metabolism
    CTU_34080 (yqeF)
   00650 Butanoate metabolism
    CTU_34080 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CTU_34080 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    CTU_34080 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTU_34080 (yqeF)
   00310 Lysine degradation
    CTU_34080 (yqeF)
   00380 Tryptophan metabolism
    CTU_34080 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTU_34080 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTU_34080 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTU_34080 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctu04147]
    CTU_34080 (yqeF)
Enzymes [BR:ctu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CTU_34080 (yqeF)
Exosome [BR:ctu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTU_34080 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF840
Motif
Other DBs
NCBI-ProteinID: CBA33429
UniProt: C9XZN2
Position
complement(3564315..3565565)
Genome map
AA seq 416 aa AA seqDB search
MFKHSRNDFITSGYYVPVHFPEITMKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEA
LLARTGLNPQDVDEVILGQVLTAGAGQNPARQTALNSGLPWSVSAITINDVCGSGLKALH
LATQAIQCGEADVVIAGGQENMSRAPHVLTEGRSSAPADSHIIDSLVHDGLWDAFNDYHM
GVTAENLAREYNISREHQDAYALASQHKARAAVDSGRFRDEIVPVVIEQRQGAPLVVDTD
EQPRADTSAEGLARLSPAFDRLGSVTAGNASSINDGAAAVLMMSASKAQEMGLPVLARIR
AFASVGVDPALMGIAPVYATRRCLERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERK
VNVNGGAIALGHPIGASGCRILVSLVHEMVKREARKGLATLCIGGGQGVALAIERD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atttttaaacattcacgaaatgattttataacaagcggctactatgtcccggttcacttc
ccggagataacaatgaaagatgtggtaattgtgggggccgcacgcacgcccattggctgc
tttcaggggcagctcgcgcgtcgctcggcggtggagctcggcgctgtggttattgaggcg
ctgctggcgcgcaccgggcttaatccgcaggatgtcgatgaagtgatcctgggtcaggtg
ctgacggcgggcgcaggccagaacccggcgcggcagactgcgctgaacagcggcctgccg
tggtccgtgtcggcgattaccattaacgatgtgtgtggctccgggctgaaggcgcttcat
ctggcgacgcaggcgattcagtgcggcgaggcggatgtggtgatcgccggcggccaggag
aacatgagccgcgccccgcatgtgctgacggaagggcgcagcagcgcgcctgctgacagt
catattatcgacagcctggtgcatgacgggctgtgggatgcgtttaacgattaccatatg
ggcgtcaccgcggaaaacctggcgcgtgaatataacatcagccgtgaacatcaggacgca
tatgcgctcgcgtctcagcataaagcgcgcgcggccgtcgacagcgggcggtttcgtgac
gagatcgtgccggtggtgattgagcagaggcagggcgcgccactggtggtggataccgac
gagcagccgcgcgccgacaccagcgcggaagggctggcgcgtctgtcgcctgcctttgac
aggctcgggagcgtcacggcaggtaacgcgtcgtcaatcaatgacggcgcggcggcggtg
ctgatgatgagcgccagcaaggcgcaggagatggggctgccggtgctggcgcgtattcgc
gccttcgcaagtgttggcgtcgatccggctctgatgggcatcgcgcccgtgtatgctact
cgccgctgccttgagcgtgcgggctggcagcttaatgatgtcgatcttatcgaagcgaac
gaggcgttcgcggcgcagacgctgtcggtcggtaaactgctggagtgggacgagcgcaaa
gttaacgtcaacggcggcgcgattgcgctcgggcatcctattggcgcgtccggctgccgg
atcctggtctcgctggtgcatgaaatggtgaaacgcgaggcccgtaaagggcttgccacg
ctttgcatcggcggcgggcagggcgtggcgctggcgatagagcgcgattag

DBGET integrated database retrieval system