KEGG   Cronobacter turicensis: CTU_38030Help
Entry
CTU_38030         CDS       T00999                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00630  Glyoxylate and dicarboxylate metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01200  Carbon metabolism
Module
ctu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CTU_38030 (aceA)
Enzymes [BR:ctu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CTU_38030 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CBA34120
UniProt: C9Y1X8
Position
complement(3964156..3965511)
Genome map
AA seq 451 aa AA seqDB search
MACWPDPTPQQHGASAMTTTRTQQIQQLEQEWTNPRWEGIRRPYSAQDVVKLRGSVNPEC
TLAQLGAARMWRLLHGESKKGYVNSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAA
SMYPDQSLYPANSVPAVVARINNTFRRADQIQWAAGIEPGDPRYVDYFLPIVADAEAGFG
GVLNAFELMKAMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVM
GVPTLLIARTDADAADLITSDCDPYDSEFITGERTSEGFFRTRAGVEQAISRGLAYAPYA
DLVWCETSTPDLDQARRFAEAIHARFPGKLLAYNCSPSFNWKKKLDDKTIASFQEELSAM
GYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGKEGYTFVSHQQEV
GTGYFDNVTTIIQGGVSSVTALTGSTEEAQF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atcgcctgctggcctgatcctacaccacaacaacacggagcatctgccatgacaacaaca
cgtacccaacagattcagcagttagagcaggaatggacaaacccgcgctgggagggcatt
cgccgcccttatagcgcgcaggacgtggtgaaattacgcggttcggtcaatccggaatgc
acgctggcgcagcttggcgcagcaagaatgtggcgtctgctgcacggcgagtcgaaaaag
ggctacgtcaacagcctgggcgcgctgaccggtggacaggcattgcagcaggcgaaggcg
gggatcgaggcggtgtatctttccggctggcaggtcgcggcagacgccaaccttgccgcc
agcatgtatccggatcagtcgctctatccggcgaactccgtgccggcagtggtggcgcgg
atcaacaacacgtttcgtcgcgccgatcagatccagtgggcggcgggcattgagcctggc
gatccgcgctatgtcgattattttctgccgatcgtggccgatgccgaggcgggttttggc
ggggtgctgaatgcgttcgagctgatgaaagcgatgattgaagccggcgcggcggcggtg
catttcgaagatcagctcgcctcggtgaaaaagtgcggtcatatgggcggcaaagtgctg
gtacccacccaggaagctatccagaagctggtcgcagcgcggctcgcggcagacgtcatg
ggcgttccgacgctgctgattgcgcgcaccgatgccgatgcggcggatctcatcacctcc
gactgcgatccgtatgacagtgaatttattaccggtgagcgcaccagcgaaggcttcttc
cgtacccgcgcgggcgtcgagcaggcgatcagccgagggctggcctatgcgccgtacgcg
gatctggtgtggtgcgaaacttccacgccggatctcgaccaggcgcgacgcttcgccgaa
gccatccatgcccgcttccccggcaagctgctggcgtataactgctcgccgtcgttcaac
tggaagaaaaaactcgacgacaaaaccatcgcctctttccaggaggaactgtcggcgatg
gggtacaaataccagttcattacgctcgcgggtattcacagcatgtggttcaacatgttc
gatctcgcccacgcctacgcccagggcgaagggatgcggcattacgtcgagaaagtgcag
cagccggaattcgccgcaggtaaagagggttacaccttcgtgtcgcatcagcaggaggtg
ggcaccggttacttcgataatgtcacgaccattatccagggcggcgtgtcgtccgtgacg
gcgttaaccggctcgaccgaagaagcgcagttctga

DBGET integrated database retrieval system