KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0034Help
Entry
Clo1313_0034      CDS       T01933                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00900  Terpenoid backbone biosynthesis
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clo1313_0034
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Clo1313_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADU73134
Position
35989..36825
Genome map
AA seq 278 aa AA seqDB search
MKAHAKINLSLDVIGKRQDGYHEVRMIMQSIALHDEVVIEKRAAGIKVECDKPWVPEGSG
NIAYKAANLMMERYKIESGVGIKILKRIPVAAGLAGGSADAAAVIKGMNELFNLNADEAE
LMDIGKQVGADVPFCIKGGTMLSEGIGEKLTKIPSFEGVNIVLVKPKVGVSTAWVYSNLK
LNEISSRPDTELLIKAIYEKNIGCLAQNMTNVLETVTIKKYGVINDIKNELLRLGALGSM
MSGSGPSVFGIFENEKQACLAYEGLKNSEWECFVTQTI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcccatgcaaaaattaatttgtcccttgatgtaattggaaagagacaggatggt
tatcatgaggtcagaatgattatgcagtccatagctttgcatgacgaagttgtaatcgaa
aaaagggctgcaggaatcaaagtggaatgcgacaagccgtgggtgcccgaaggaagcggc
aatattgcttataaagcggcaaacctcatgatggaaaggtataagattgaaagcggcgtt
ggcattaaaatcctaaagagaattcccgtggcggcaggccttgcagggggaagtgccgat
gcggcggcggtaattaaagggatgaatgaactttttaatttgaatgctgatgaagccgaa
cttatggacatcggaaagcaggtgggagcggatgtgcctttctgcatcaagggaggaacc
atgctctccgaaggaatcggggagaagcttacaaaaatcccttcttttgagggagtgaat
attgtattggtaaaacccaaagtcggcgtgtcgacagcctgggtatacagcaatttaaag
ctgaatgaaatatcctcaagacctgataccgaacttttgataaaagcaatttatgagaaa
aatattggctgtctggcgcaaaacatgacaaatgtgctggagacagttacaataaaaaag
tatggagttataaatgatattaaaaacgagctcttgaggctcggagctttgggaagcatg
atgagcggaagcggtccttccgtgtttggcatatttgaaaatgaaaaacaggcttgtctt
gcttatgaaggccttaaaaacagtgagtgggaatgctttgttacacaaacaatataa

DBGET integrated database retrieval system