KEGG   Hungateiclostridium thermocellum DSM 1313: Clo1313_1186Help
Entry
Clo1313_1186      CDS       T01933                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ctx  Hungateiclostridium thermocellum DSM 1313
Pathway
ctx00430  Taurine and hypotaurine metabolism
ctx00620  Pyruvate metabolism
ctx00640  Propanoate metabolism
ctx00680  Methane metabolism
ctx01100  Metabolic pathways
ctx01120  Microbial metabolism in diverse environments
ctx01200  Carbon metabolism
Module
ctx_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clo1313_1186
   00640 Propanoate metabolism
    Clo1313_1186
  09102 Energy metabolism
   00680 Methane metabolism
    Clo1313_1186
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Clo1313_1186
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Clo1313_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADU74250
Position
1408931..1410130
Genome map
AA seq 399 aa AA seqDB search
MNILVINTGSSSLKYQLIDMTNESVLAKGVCDRIGLEHSFLKHTKTGGETVVIEKDLYNH
KLAIQEVISALTDEKIGVIKSMSEISAVGHRIVHGGEKFKESAIIDEDVMKAIRDCVELA
PLHNPSNIIGIEACKQILPDVPMVAVFDTAFHQTMPRHAYIYALPYEIYEKYKLRKYGFH
GTSHKYVAHRAAQMLGKPIESLKLITCHLGNGASICAVKGGKSVDTSMGFTPLQGLCMGT
RSGNVDPAVITYLMEKEKMNINDINNFLNKKSGVLGISGVSSDFRDVQDAAEKGDDRAQL
ALDIFCYGVRKYIGKYIAVLNGVDAVVFTAGIGENNAYIRREVLKDMDFFGIKIDLDKNE
VKGKEADISAPDAKVKTLVIPTNEELEIARETLRLVKNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttggttattaataccggaagctcatcactaaagtatcagctgattgacatg
acaaacgagtctgtgcttgcaaaaggtgtgtgtgacagaattggtcttgaacattccttt
ttaaagcatacaaagaccggaggggaaaccgtagttatagaaaaagacctgtacaatcac
aagcttgccatacaggaggtaatttcggctcttacggatgaaaaaatcggagtcataaaa
agcatgtcggaaatttctgccgtcggtcatcgtattgttcacggcggagagaagtttaag
gaatctgccataattgatgaagatgtaatgaaagcaatcagggattgtgttgaactggct
ccgctccacaatccgtcaaatataatcggaattgaagcctgtaaacagatactgcccgat
gtgccgatggttgctgtgtttgacacagcttttcatcagacaatgccaaggcatgcatat
atttatgccctcccttatgagatatatgagaagtataaattgagaaaatacggattccac
ggaacttcccacaaatatgtggcccacagggcggctcagatgctgggcaaacctattgag
agcctgaagctgataacctgccatcttggaaacggagcgagtatttgtgcggtaaaaggc
ggaaaatccgttgacacctcaatgggatttactcctctgcaggggttgtgcatgggtacc
agaagcggcaatgttgaccctgcggttataacttatttgatggaaaaggaaaaaatgaat
attaacgatataaacaatttccttaacaagaaatcaggtgtgcttggaatttcaggtgta
agcagtgatttcagagatgttcaggatgccgcagaaaagggagatgacagggcgcagctg
gcattggatattttctgctatggtgttaggaaatatattggaaaatatattgcagtgctg
aacggcgttgatgcggtggtattcactgcaggtatcggcgaaaacaatgcttatataaga
agagaagttttgaaggatatggactttttcggaattaaaatagatttggataaaaatgaa
gtgaaaggcaaagaagcggatatcagtgctcccgatgcgaaagtaaagactttggttatc
ccgacaaatgaggagcttgagattgcaagggagactttaagacttgtaaaaaacttataa

DBGET integrated database retrieval system